(data stored in ACNUC7421 zone)

EMBL: CP000489.PE627

CP000489.PE627       Location/Qualifiers
FT   CDS_pept        complement(608217..608687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0632"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: jan:Jann_0031 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68744"
FT                   /db_xref="GOA:A1AZQ0"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZQ0"
FT                   /protein_id="ABL68744.1"
FT                   /translation="MATKSDPNYKIIAENRRARFDYFIESDLEVGIVLTGSEVKSLRTG
FT                   QSNIAESYASVENGELWLINAYIAAYKQAGVFGHEERRRRKLLVSRKELARLWQAIGRE
FT                   GMTLVPLVMYFNDRGKVKLKIGVAKGKKVADKRETAAKRDWNRQKQRLLKQG"
     atggccacga aatccgaccc gaactacaag atcatcgccg agaaccgccg ggcgcgcttc        60
     gattacttca tcgaaagcga tctcgaggtc ggcatcgtgc tgaccgggtc cgaggtgaaa       120
     agcctgcgca ccggccagtc caacatcgcc gaaagctatg cctcggtcga gaatggcgag       180
     ctgtggctga tcaacgccta tatcgccgcc tacaagcagg ccggcgtctt tggccatgag       240
     gagcggcggc ggcgcaagtt gctggtctcg cgcaaggaac tggcgcggtt gtggcaggcc       300
     atcgggcgcg agggcatgac gctggtgccg ctggtcatgt atttcaacga ccgcggcaag       360
     gtgaagctga agatcggcgt cgccaagggc aagaaggtcg ccgacaagcg cgaaaccgcc       420
     gccaagcgcg actggaaccg gcagaaacag cgtttgctga agcagggtta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page