(data stored in ACNUC7421 zone)

EMBL: CP000489.PE628

CP000489.PE628       Location/Qualifiers
FT   CDS_pept        608839..610500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0633"
FT                   /product="thiamine pyrophosphate enzyme TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: jan:Jann_0137 thiamine pyrophosphate enzyme-like
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68745"
FT                   /db_xref="GOA:A1AZQ1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ1"
FT                   /protein_id="ABL68745.1"
FT                   /translation="MRHGGQILVDALKTNGVGRVFSVPGESFLAVLDGLYASGIRNVVC
FT                   RHEGGAAMMAEAHGKLTGRPGVGFVTRGPGATNASAGVHVARQDGTPMILFVGQIARAD
FT                   RDRDAFQEVDYRAMFGPLAKWVAEIDQTERIPEYVSRAFHLAMSGRPGPVVLALPEDMI
FT                   SARAEVPDLPPPAAPLAAVAAESVEAVAQALAGAERPLVVPGGTLWSQAAADDLARFAE
FT                   SWGLPVAVPFRRQGHIDNAHPNYVGDLGVGMNPALGQALSQADCVLSLGSRLGDTLTRG
FT                   YELMDPVRPHARVIHVHPSPDELGRLWRPDPGLAADPRVVVAALAALPVPRRWDGWTAG
FT                   LRAAYEAWQQPRPTPGAVRMEAVVRWLSDHLPPDAIITNGAGNYAAFVHRYYRFRRWGT
FT                   QLAPTSGSMGYGLPAAIAAKLEHPGRSVVCMAGDGCLQMTVNELSTAAQHGAAVIVIVA
FT                   NNGHYGTIRMHQERSYPGRVSGTALANPDFVALARAYGGHGETVTRQEDFADAFARAQA
FT                   AGRLAVLELMLDPEALSTGATLAETRAAGAAGLRRA"
     atgcggcacg gtgggcagat tctggtcgat gcgctgaaga cgaacggggt cgggcgggtg        60
     ttctcggtcc ccggcgaaag ctttctggcg gtgctggacg ggctttacgc atccggcatc       120
     cggaacgtcg tctgccggca cgagggcggc gccgcgatga tggccgaggc gcatggcaag       180
     ctgacaggac ggcccggcgt gggtttcgtc acccgcggcc ccggcgccac caatgccagc       240
     gccggggtgc atgtggcgcg gcaggatggc acgccgatga tcctgttcgt cggccagatc       300
     gcccgcgccg accgtgaccg cgacgccttt caggaggtcg attaccgcgc catgttcggc       360
     ccgctggcga aatgggtggc cgagatcgac cagaccgagc gcataccgga atatgtctcc       420
     cgcgcctttc atcttgccat gtcgggccga cccggccccg tggtgctggc gctgcccgag       480
     gacatgatct cggcccgggc cgaggtgccg gacctgccgc cgcccgctgc gccgctggcc       540
     gctgtggccg cggaatcggt cgaggccgtc gcgcaggcgc tggccggggc cgaacgtccg       600
     ctggtcgtgc ccggcgggac gctgtggtcg caggcggccg ccgacgacct ggcgcgcttt       660
     gccgaaagct ggggcctgcc cgtcgcggtg cccttccgcc gccaggggca tatcgacaat       720
     gcgcatccga actatgtcgg cgacctgggc gtcggcatga acccggcgct ggggcaggcg       780
     ctttcgcagg cggattgcgt gctttcgctg ggctcgcggc tgggcgacac gctgacgcgc       840
     ggctacgagc tgatggaccc ggtgcgcccg catgcccggg tgatccatgt ccacccctcg       900
     cccgacgagc tggggcgtct gtggcggccc gatccggggc tggcggcgga cccgcgcgtg       960
     gtggttgcgg cgctggccgc cttgccggtg ccgcggcgct gggacggctg gaccgccggg      1020
     ctgcgcgcgg catacgaggc ctggcagcag ccgcgcccca cccccggcgc cgtgcggatg      1080
     gaggcggtgg tgcgctggct gtccgaccat ctgccgccgg atgcgatcat caccaacggc      1140
     gccgggaact atgcggcctt cgtccatcgc tattaccgct ttcgccgctg gggcacgcaa      1200
     ctggcgccga cctcgggctc gatgggctac ggcctgcccg ccgccatcgc cgccaagctg      1260
     gagcatcccg gccgcagcgt ggtttgcatg gccggcgacg gctgcctgca aatgacggtg      1320
     aacgagcttt ccaccgccgc ccagcatggt gccgccgtca tcgtcatcgt ggcgaataac      1380
     ggccattacg gcaccatccg catgcatcag gagcgcagct atcccggtcg tgtctcgggc      1440
     acggcgctgg ccaatcccga tttcgtcgcg ctggcccggg cctatggcgg ccatggcgag      1500
     acggtaaccc ggcaggagga cttcgcagat gccttcgccc gggcgcaggc ggcgggcagg      1560
     ctggcggtgc tggagttgat gctcgacccc gaggcgctga gcacgggggc cacccttgcc      1620
     gaaacccgcg cggcgggcgc ggccgggttg cgccgggcct ag                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page