(data stored in ACNUC7421 zone)

EMBL: CP000489.PE632

CP000489.PE632       Location/Qualifiers
FT   CDS_pept        complement(612897..614948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0637"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; Penicillin-binding domain protein;
FT                   KEGG: sil:SPO0135 penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68749"
FT                   /db_xref="GOA:A1AZQ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ5"
FT                   /protein_id="ABL68749.1"
FT                   /translation="MRSRRFALSLMAAVLVLGIGAGARDRFDDWVDATALPRLEVPVGA
FT                   EVVARDGTLLRAFQVADGRWRLDAGPVDPLFLDMLLLWEDRRFPGHSGIDARALLRAGV
FT                   QALRHGRVVSGGSTLTMQAARLIEDGPTGQWAGKGRQMRLALALERRLGKREIMELYLR
FT                   LAPYGANVEGIRAASLQWFGKEPRRLTPAQAALLVALPQSPETRRPDRFPERATAARDR
FT                   VLARAARAGLISDADARAAMAEPVPRVRRAFPALAPLLAARLVREHPGALRIETTIDAR
FT                   LQRRAEELASRAVRGAGRRLSAAVVLADHRNGEILAEVGAADWTDGASAGFVDMARAWR
FT                   SPGSTLKPFVYGLAFDDGLAHPETLIEDRPTVFGRWQPQNFDHHFRGTVSLKNALIWSL
FT                   NIPVVKLADAVGPNRVTQALRRGGVELRLPGEVPGLAVVLGGAGVTLEGLAEGYAALAR
FT                   GGRGITLSALPGGGEERPAPMFGPVAAWQVGNILGQNPAPQGVRQRVLAYKTGTSYGHR
FT                   DALAVGFDGARVGAVWLGRPDGTPVPGAFGGDLAAPVLFDLFDALPSVALPPPPPQTLT
FT                   LPNSALPLPLRRFAPAGTASAMAARPAGPDALRLTYPPDGAEIDARGPLTAKARGGRGP
FT                   WTFLLNGAPAAIAQPQPLASLPNPGPGFAELTVVDADGASATAAIRLH"
     atgagatcgc gccgcttcgc cctgtcgctg atggctgccg ttctggtcct gggcatcggg        60
     gccggggcgc gggatcggtt cgacgattgg gtcgatgcga cggcgctgcc gcggctggag       120
     gtgccggtgg gggccgaggt cgtcgcgcgg gacggcaccc tcttgcgggc gttccaggtc       180
     gcggacgggc gctggcggct ggatgcgggg ccggtcgatc cgctgtttct cgacatgctc       240
     ctgctgtggg aggaccggcg gtttccgggc cattccggca tcgatgcacg ggcgctgctg       300
     cgcgcgggcg tgcaggcgct gcggcatggc cgcgtggtct cgggcggctc gaccctgacc       360
     atgcaggccg cccggctgat cgaggacggg ccgaccgggc aatgggccgg caaggggcgg       420
     cagatgcggt tggccctggc gctggagcgg cggctgggca agcgcgagat catggagctt       480
     tacctgcgcc tcgcccccta tggcgccaat gtcgagggca tccgcgccgc cagcctgcaa       540
     tggttcggca aggagccgcg gcggctgacg ccggcgcagg ccgcgctgct ggttgcgctg       600
     ccgcaatcgc ccgagacgcg gcggccggat cgtttccccg agagggccac ggccgcgcgc       660
     gaccgggtgc tggcgcgggc ggcgcgggcc gggctgattt cggatgccga tgcgcgggcg       720
     gcgatggccg agccggtgcc gcgcgttcgc cgggcctttc cggcgctggc gccgctgctg       780
     gccgcgcggc tggtgcgcga gcatcccggc gccttgcgga tcgagaccac catcgatgcg       840
     cgcctgcagc gccgggccga ggaactggcc tcgcgcgccg tgcgcggcgc cgggcggcgg       900
     ctgtcggcgg cggtggtgct ggcagatcac cgcaacggcg agatcctggc cgaggtcggc       960
     gcggcggact ggaccgatgg cgcatccgcc ggcttcgtcg acatggcgcg ggcctggcgc      1020
     agccccggat cgacgttgaa gccctttgtc tacgggctgg ccttcgacga cgggctggcg      1080
     catcccgaga cgctgatcga ggaccggccg accgtcttcg gccgctggca gccgcagaac      1140
     ttcgaccatc atttccgcgg caccgtcagc ctgaagaacg cgctgatctg gtcgctgaac      1200
     atcccggtgg tgaagctggc cgatgccgtg gggccgaacc gcgtcacgca ggcgctgcgc      1260
     cggggcgggg tggaactgcg cctgcccggc gaggtgccgg ggctggccgt cgtgctgggc      1320
     ggtgcgggcg tgacgctgga ggggctggcc gagggctatg cggcgctggc ccgcggcggg      1380
     cggggcatca cgctgtcggc cctgccgggt gggggcgagg agcggccggc gccgatgttc      1440
     ggcccggtcg ccgcctggca ggtcggcaat atcctcggcc agaaccccgc cccacagggc      1500
     gttcggcaac gcgtgctggc ctacaagacc ggcacctcct acgggcatcg ggacgcgctg      1560
     gcggtggggt tcgacggcgc gcgggtgggc gcggtctggc tggggcggcc ggacgggacg      1620
     cctgtgcccg gcgcctttgg cggcgatctg gcggcgccgg tgctgttcga cctgttcgac      1680
     gcgctgccct cggttgcgct gccgccgcct ccgccgcaga cgctcacgct gcccaacagc      1740
     gccctgcccc tgcccttgcg ccgctttgcc ccggcgggca cggccagcgc catggcggcc      1800
     cgccccgccg gcccggacgc gctgcgcctg acctatccgc ccgacggcgc cgagatcgac      1860
     gcacggggac cgctgaccgc caaggcgcgg ggcgggcgcg ggccatggac ctttcttctg      1920
     aacggcgcgc ccgccgccat cgcccagccg cagcccctgg ccagcctgcc caatcccggt      1980
     ccgggctttg ccgaattgac ggtggtggat gcggatgggg cctcggcgac tgcggcaatc      2040
     cggctgcact ga                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page