(data stored in ACNUC7421 zone)

EMBL: CP000489.PE633

CP000489.PE633       Location/Qualifiers
FT   CDS_pept        complement(615033..616142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0638"
FT                   /product="conserved hypothetical protein 1620"
FT                   /note="PFAM: conserved hypothetical protein 1620; KEGG:
FT                   sil:SPO3140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68750"
FT                   /db_xref="GOA:A1AZQ6"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ6"
FT                   /protein_id="ABL68750.1"
FT                   /translation="MAEPPKRRGPVLMEMGAEPQAPRSEPMPEPRTDQRDRKAPRAEWR
FT                   EGEPAPSPADAPMIDDGLAPPLPQPRTMQLVARLVGRGPSRLTRFFINTGVALFTFLLS
FT                   VAALRYLTDLLNSYPLLGWIGIALMVLFCIAALGMAWREYRAWSRFAAIDGINRDAGAA
FT                   LASGDLKAAQHVVGRMESLYRARPELEWGLTRLRERKGDAYDAQTLIALAETELLAALD
FT                   QQARREIEAAARTVAAATALIPLALADVIAALAANLRMIRRMAEIYGGRAGAVGGWRLA
FT                   RTVMTHLIATGAVAAGDDLIHTVAGGGLLAKVSKRFGEGVVNGALTARVGIAAMEVCRP
FT                   LPFIHQPRPKVGNLIARGLKGLFGEDEAK"
     atggctgaac ctccgaaacg gcgcgggccg gtgctgatgg aaatgggcgc ggaaccccag        60
     gcgccgcgct ccgagcccat gccggagccc cgcaccgacc agcgcgaccg caaggcgccg       120
     cgggccgagt ggcgagaggg cgaacccgcg ccctcgcccg ccgatgcgcc gatgatcgac       180
     gacgggctgg ccccgccgct gccgcaaccg cgcaccatgc agcttgtcgc gcggctggtc       240
     gggcgcgggc cgtcgcggct gacgcgcttc ttcatcaata ccggcgtggc gctgttcacc       300
     ttccttttgt cggtggcggc gctgcgatat ctgacggatc tgctgaacag ctatccgctg       360
     ctcggctgga tcggcatcgc gctgatggtg ctgttctgca tcgcggcgct ggggatggcc       420
     tggcgcgaat accgcgcctg gtcgcgcttt gccgccatcg acggcatcaa ccgcgatgcc       480
     ggggcggcgc tggcatcggg cgacctgaag gcggcgcagc atgtggtcgg gcggatggag       540
     agcctttacc gcgcccggcc ggagctggaa tggggcctga cccggctgcg cgagcgcaag       600
     ggcgacgcct atgatgccca gacgctgatc gcgctggccg agaccgagtt gctggcggcc       660
     ctggaccagc aggcccggcg cgagatcgag gccgccgccc gcaccgtcgc cgccgccacc       720
     gcactgatcc cgctggcgct ggccgatgtg atcgcggccc tggcggcgaa cctgcggatg       780
     atccgccgca tggccgagat ctatggcggc cgcgccggcg ccgtgggcgg ctggcggctg       840
     gcgcgcacgg tgatgacgca tctgatcgcc accggcgcgg tcgcggccgg ggacgacctg       900
     atccacaccg tcgccggggg cgggctgctg gccaaggtct cgaagcgctt cggcgagggt       960
     gttgtgaacg gcgcgctgac cgcccgggtc ggcatcgcgg cgatggaggt ctgccggccc      1020
     ctgcccttca tccatcagcc ccggcccaag gtcggcaacc tgatcgcccg cgggttgaag      1080
     gggctgttcg gcgaggacga ggcgaagtag                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page