(data stored in ACNUC7421 zone)

EMBL: CP000489.PE68

CP000489.PE68        Location/Qualifiers
FT   CDS_pept        65122..66750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0068"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: sme:SMa2171
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68185"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY41"
FT                   /protein_id="ABL68185.1"
FT                   /translation="MSNAAQTLPDDPALLKSLIAALQAENAKISATLRAHDQLIQSLRL
FT                   RIARLKKQVFGQSSEKIEREIEQLELALEDLMIAAAEGQPDVVNDGQNDDGLETAPADE
FT                   AAERPSRRRPRVSDSTPRERRELDPGSCCPDCGGDLRLVGEDVSEMLDLIAAQLKVVQI
FT                   ARLKKSCRRCERMVQMPAPSRPIPGSMAGANLLAHILVSKFDDHLPLYRQHEIFTRMGA
FT                   DIPDSTLVDWCGRAMKVLAPLIERIEVDVMASDLLHADDTPIRVLDRAGRDKGVGKGVK
FT                   KGRIWAYVRDQRPWAGASPPGAVYAFAPDWKEEHVHGHLANTRGILQADGYKGYAKLYE
FT                   PEPDGKPRLREAACWAHLRRDFHDEWTKTKSTIAREALDRIGALYDIEREITGHPADIR
FT                   LAARRKHSVPKVEVFFAWSEQQLSRIPGKGDLAKAFRYGLSRRDAFSLFLEDGRVAIDN
FT                   NPAERALRPIGVGRRNWLFAGADTGAETLARAMTIVETAKMNGLDPQAYLADILARIHD
FT                   HKINRLDDLLPWNWSPLPSALHEAA"
     atgtcgaatg cggcccagac ccttcctgat gatccggcgc ttctgaagtc gctgatcgcg        60
     gcgttgcagg cggaaaacgc gaagatctcg gccacgttgc gcgcccatga ccagttgatc       120
     cagtccctgc ggctgcgcat tgccaggctg aagaagcagg tcttcggcca gtcctcggaa       180
     aagatcgagc gcgagatcga acagctggag ctggcgctcg aggatctcat gatcgcagcg       240
     gccgaaggcc agcctgacgt cgtgaacgac ggccaaaacg atgatgggtt ggaaacggca       300
     cctgccgatg aagctgccga gcgcccatcc cgccgacgtc cccgggtctc ggacagcacg       360
     ccgcgcgagc ggcgggagct cgaccccggc agttgctgcc ccgattgcgg cggcgatttg       420
     cgcctggtgg gcgaagatgt cagcgagatg ctggatctga tcgcggcaca attgaaggtt       480
     gtccagatcg cccgcctgaa aaagtcctgc cgccgctgtg aacgcatggt gcagatgccg       540
     gcccccagcc ggccgatccc cggcagcatg gccggtgcga acctgctcgc ccacatcctc       600
     gtctccaagt ttgacgacca ccttccgctt tatcgccagc atgagatctt cacccggatg       660
     ggcgccgaca tcccggacag taccttggtc gactggtgcg gtcgcgccat gaaggtgctg       720
     gcaccgctga tcgagcggat cgaggtggat gtgatggcca gcgacctcct tcatgccgat       780
     gacacaccga tccgggtgct ggatcgcgcg ggccgcgaca agggggtggg caagggtgtg       840
     aagaagggcc ggatctgggc ctatgtccgc gatcagcgcc cttgggcagg cgcctcaccg       900
     cccggcgcgg tctatgcctt cgcgcccgac tggaaggaag agcacgtcca cggccatctc       960
     gccaacaccc gcggcattct ccaggccgat ggctacaagg gttatgccaa gctctatgaa      1020
     ccggaacccg acgggaagcc ccgccttcgg gaggccgcgt gttgggctca cctgaggcgt      1080
     gacttccatg atgaatggac caagaccaaa tcaacgatcg cccgcgaggc actcgaccgt      1140
     atcggcgcgc tctatgacat cgagcgggag atcaccggcc atcccgccga tatccgcctt      1200
     gccgcgcgcc ggaaacacag cgttccgaag gtcgaggtct tcttcgcctg gtcagagcag      1260
     cagctctcgc ggatccccgg caagggcgat ctggccaagg cctttcgtta cgggctgagc      1320
     cgccgggacg ctttcagcct gttccttgag gacggccggg tggcgatcga caacaatcct      1380
     gccgagcgcg cgctgcgccc gatcggtgtc gggcgccgca actggctctt cgccggtgcg      1440
     gataccggag ccgaaacgct ggcccgcgcc atgaccatcg ttgaaaccgc caagatgaac      1500
     ggcctggacc cccaagccta tctggccgac atcctggccc gcatccatga tcacaagatc      1560
     aatcggctcg acgatctgtt gccctggaac tggtcgccgc tgccctccgc cctgcacgag      1620
     gccgcctga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page