(data stored in ACNUC7421 zone)

EMBL: CP000489.PE69

CP000489.PE69        Location/Qualifiers
FT   CDS_pept        66750..67046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa1608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68186"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY42"
FT                   /protein_id="ABL68186.1"
FT                   /translation="MATVTHVCTLDYIAKMLGEDPELLKAIVYNDDNLTYGSIISVYTG
FT                   PDDTVTALTDDGIDELKDMLRDARITTETWHAFLDDFVDDAELVARIKAQSPR"
     atggcaaccg tcacccacgt ctgcaccctc gactacatcg caaagatgct gggcgaagac        60
     cccgagcttc tcaaagccat cgtctacaac gacgacaacc tgacctatgg ctcgatcatc       120
     agcgtctata ccggcccgga tgacaccgtc accgccctga ccgatgacgg tatcgatgaa       180
     ctgaaagaca tgctcaggga cgcgcgcatc accaccgaaa cctggcacgc gttcctcgac       240
     gactttgtcg atgacgcgga actcgtcgcc cgcatcaagg ctcagtcgcc gcggtaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page