(data stored in ACNUC7421 zone)

EMBL: CP000489.PE7

CP000489.PE7         Location/Qualifiers
FT   CDS_pept        6517..7395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0007"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: rsp:RSP_1225 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68124"
FT                   /db_xref="GOA:A1AXY0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY0"
FT                   /protein_id="ABL68124.1"
FT                   /translation="MAENKLEKRGLGRGLSALMADVDLIPSERPAPRQILPVEQLTPNP
FT                   DQPRRSFAPEALQELADSLKTRGMLQPLIVRPHPTDRGLYQIVAGERRWRAAQIAQLHE
FT                   VPVIVRDLNDTEVLEVAIVENIQRADLNAIEEAASYRQLMDRFGHTQEKLGEALNKSRS
FT                   HIANLLRLLNLPEQVQAWLKEGKLTAGHARALITASNAVELARKVIEKNLSVRETEELV
FT                   RRQAEGPKAQKSRSASQEKDADTRALEGDLTAHLKMKVAINHSGTDGGQLVITYRDLDQ
FT                   LDRLCQILAGD"
     atggcagaga acaagcttga aaagcgcggt ctgggccgtg gattgtcggc gttgatggcc        60
     gatgtggatc tgattccttc cgagcgtccc gcgccccggc agatccttcc ggtcgaacag       120
     ctgacgccga acccggatca gcctcgccgc agttttgccc ctgaagcgtt gcaggagctt       180
     gccgattcgc taaagactcg cggcatgctg cagccgttga tcgtgcgccc gcatccgacc       240
     gatcgcggcc tttaccagat cgttgctggc gagcgccgtt ggcgtgccgc tcagatcgcc       300
     cagctccatg aggtgccggt catcgttcgc gatctgaacg atacggaagt gctggaagtc       360
     gccattgtcg agaacatcca gcgtgccgac ctgaacgcga tcgaggaggc ggcttcttat       420
     cgccagctca tggacaggtt cggccacacc caggaaaagc tgggcgaggc gcttaacaag       480
     agccgcagcc atatcgccaa cctgctgcgg ctgctgaacc tgccggagca ggtgcaggcc       540
     tggctcaagg aaggcaagct gactgccggc catgcccggg cgctgattac cgcatccaat       600
     gccgtcgagc ttgcgcgcaa ggtgatcgag aagaaccttt ccgtgcgcga gactgaagaa       660
     ctggtgcgtc gccaagccga aggccccaag gcgcagaaat ccaggagcgc cagccaggaa       720
     aaggatgccg acacccgcgc gctggaaggc gatttgaccg cgcatctcaa gatgaaggtg       780
     gcgatcaacc attccgggac cgacggtggc cagcttgtga tcacctatcg cgaccttgat       840
     cagcttgatc gtctttgcca gatccttgcc ggcgactga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page