(data stored in ACNUC7421 zone)

EMBL: CP000489.PE76

CP000489.PE76        Location/Qualifiers
FT   CDS_pept        complement(70813..71199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68193"
FT                   /db_xref="GOA:A1AY49"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY49"
FT                   /protein_id="ABL68193.1"
FT                   /translation="MNPFCQHALVAPGDRHVNRRDSEDYSGSQIGHCINRAKRKRPASS
FT                   ANQRDCSPFSSSDDDQPSAYLVVFLFLVSGWAIMIIALTATACWILDMSLMSIIYGYLG
FT                   GGVFGAMVAIIGSLLVHETRHDAG"
     gtgaatccct tttgtcaaca cgccctagtg gctcccggcg acaggcacgt caatcggcgt        60
     gatagtgaag attattcagg ttctcaaatc ggtcattgca taaatagagc gaaacgcaag       120
     cgtcctgcca gtagcgccaa tcaaagggat tgctctccct tttcgagttc ggacgatgat       180
     caaccctcgg cctatctcgt cgtattcctc tttctggtat cgggatgggc gatcatgatc       240
     atcgctttga ccgcgactgc ctgttggatt ctcgatatga gccttatgtc gattatctac       300
     ggatatctgg gcggcggtgt gttcggagcc atggtcgcga tcatcggatc attgcttgtg       360
     catgaaacac ggcacgatgc aggctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page