(data stored in ACNUC7421 zone)

EMBL: CP000489.PE79

CP000489.PE79        Location/Qualifiers
FT   CDS_pept        72151..72867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0079"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: nar:Saro_0441 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68196"
FT                   /db_xref="GOA:A1AY52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY52"
FT                   /protein_id="ABL68196.1"
FT                   /translation="MTGEQKGIRVLLVEDEETVLQLHGAVLVGAGCVVDEAPTLACFRD
FT                   RIARSRYDIVLLDLCLPDGNALEAISEIRRGTSAGIIVATSNRDPDDRLTGLEQGADEY
FT                   LEKPVHPRELVARVRNLAGRLAVAKREEKMELVHHFQGWSVDLAARTVRLHDGDTLQLT
FT                   ENEFRLLDVLIRNAAKPVHRERLLTALGSDEEATDRAVDKAIYRLRVKLHAVLGHATPL
FT                   IETVHGFGYRFIAEIL"
     atgacgggtg agcagaaggg tatccgggtg cttctggttg aagatgaaga gacggtgctg        60
     cagcttcatg gcgccgtgct ggtcggtgcg ggttgcgtcg tggacgaagc gcccactctc       120
     gcctgcttcc gggacaggat tgcccgctcg cgttatgaca tcgttctgct tgatctgtgt       180
     ttgcccgatg gcaatgcgct ggaggcgata tccgagattc gccggggcac gtcggccggg       240
     atcatcgtcg caacctcgaa ccgcgacccc gacgatcggc tgaccggcct ggaacaggga       300
     gcggacgaat atctggaaaa gcccgtgcat ccgcgcgagc tggtcgcgcg cgtgcgcaac       360
     cttgcggggc ggctcgcggt cgcgaagcgc gaggagaaga tggagttggt ccaccacttc       420
     cagggctgga gcgtcgatct ggcggcgcga accgtcaggc ttcacgacgg cgacacgctg       480
     caattgacgg aaaacgagtt tcgcctgctg gacgtgctga tccgaaatgc tgcgaagccg       540
     gtgcatcggg aacgcttgct gaccgcgttg ggcagcgacg aggaggcaac ggaccgggcg       600
     gtcgacaagg ccatctatcg attgcgggtc aagctgcatg cggtcctggg ccatgccacc       660
     cccctgatcg agacggtgca tggcttcggc tatcgcttca tcgcggagat cctctag          717
//

If you have problems or comments...

PBIL Back to PBIL home page