(data stored in ACNUC7421 zone)

EMBL: CP000489.PE80

CP000489.PE80        Location/Qualifiers
FT   CDS_pept        72869..75208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0080"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; KEGG: ccr:CC0026 sensory box histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68197"
FT                   /db_xref="GOA:A1AY53"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY53"
FT                   /protein_id="ABL68197.1"
FT                   /translation="MAGVPPDSRRAAMADEAESMTTFAVLRPDGLISYCSAPFAHLLGS
FT                   EERVVVGTPIGAWLRPVEGAGSGWFAVVRQSEGHLLRTGGVGQFRYRLDPMAGGGAVLH
FT                   LMQGTGNLDPIYARAFQLNPGLSALSVLDTGEHLDVNDAWLRNMEYRREEVIGRTASEM
FT                   QVWEQGDTSRTEIVRRLREDGKIENFQARMRTRTGKLRDILVSAELVEHAGRKLAFFAS
FT                   HDITEVKKAQEELEALNRQLEQRIAERTAEIVRKNRELAEAAERAQAANEAKSQFLSVM
FT                   SHEIRTPLNALLNMAELLIEDGNPAPAAAHLSGIASSARALAAIVDDVLDFSRIESGHL
FT                   EIYPAATDIGRLCEEAVRGVAPLAHRKGLDIVLTFGQRLPATAMVDPLRLRQILFNLVG
FT                   NAIKYTRKGWIEVRADVTGETAEPQLLVEVIDTGIGIRPNDLERIFERFSRIGADANHE
FT                   IHGAGLGLNISAGLARAMGGTIRVESEVDRGSAFRVTLPLVTCGELAEDPLRQPLQGRV
FT                   ALLGPATRTRSTFEAILKRQGVVAQRVLSASGAQVITMESGRSAIDCAMRQSFDILLLD
FT                   LRMPDLSGYETAVRIRALGGWAADVPIVAVSANIAPDKAQMQAAGIDGFLAKPFTPTAL
FT                   RAKVQGHLHHSAGDTEPDDSIRADATPVLDESFLAAQVTYAGPDAVGKAIAGFLGNLDG
FT                   RLSRIWSGADARERADAAHMLAGAAGALGLLDLATHCRRLASDRGDSPTASLRQDRDIL
FT                   ASSAGRAVAALREVRDKLAAGSSRQD"
     atggccggcg tcccgccgga ctcccggaga gccgcgatgg ccgatgaagc tgaaagcatg        60
     accaccttcg ccgttctgcg gccggatgga ctgatcagtt attgcagcgc gccctttgcg       120
     cacctgcttg gttccgagga acgggtggtt gtcggcacgc ctatcggtgc atggcttcgc       180
     cccgtcgagg gggcggggtc cggatggttc gctgtcgtcc ggcagtcaga gggacatctt       240
     ttgcggacag gtggagtcgg gcaattccgt taccggctcg atcccatggc cggaggcggt       300
     gcggtgctgc atctgatgca ggggaccgga aacctcgacc cgatctatgc gcgggccttc       360
     cagctcaatc ccggcctgtc cgccctttcg gtcctggaca ccggagagca tctggatgtc       420
     aacgacgcct ggctcaggaa catggaatat cggcgcgagg aggtgatcgg ccgcaccgca       480
     agcgagatgc aggtgtggga gcagggcgat acgagccgga cggaaatcgt tcgcaggctg       540
     cgcgaggatg gaaagatcga gaacttccag gcccggatgc ggacacggac cggtaagctg       600
     cgagacatcc tggtcagcgc cgagcttgtc gaacatgcgg gccggaagct ggccttcttt       660
     gcttcgcacg acatcaccga agtgaagaag gcgcaagagg aactcgaagc gctgaaccgg       720
     caactcgaac agcggatcgc cgagcggacc gcggagatcg tgcggaagaa ccgcgaactt       780
     gccgaggcgg ccgaacgcgc ccaggcggcg aacgaggcca agagccaatt cctgtcggtc       840
     atgagccatg aaatccgcac gccgctgaat gcactgctca acatggccga gttgctgatc       900
     gaggacggca accctgcgcc cgccgcggcc catctgtccg gcatcgccag ttccgcacgc       960
     gcgctggccg ccatcgtgga cgatgtgctg gacttttccc gcatcgagtc cggccacctg      1020
     gaaatctacc ccgccgcgac ggatatcggc cggctttgcg aagaagccgt gcgcggcgtc      1080
     gcaccactgg cgcatcggaa ggggctggat atcgtcctga ccttcggaca gcggctgccc      1140
     gcaaccgcga tggtggaccc gctgcggctg cgccagatcc tgttcaacct tgttggcaat      1200
     gccatcaaat atactcggaa aggctggatc gaggtcaggg ccgatgtcac gggcgaaacc      1260
     gcggaacccc agttgctggt cgaggtgatc gataccggga tcggcatccg tcccaacgat      1320
     ctggagcgga tattcgaacg attttcccgc atcggcgctg atgccaacca cgagatccac      1380
     ggcgcagggc ttggcctgaa catttcggcc gggctggccc gggccatggg cggcacgatc      1440
     agggtcgaaa gcgaggtcga ccggggcagt gccttccgcg tgaccttgcc gctggtaaca      1500
     tgcggcgagc ttgccgagga ccccttgcgc caacccttgc aaggccgcgt ggccctgctc      1560
     ggcccggcca ccaggactcg ctcgacattc gaagcgatcc tgaagaggca gggggtggtc      1620
     gcgcaacggg tgttgtcggc ctccggtgcc caggtgataa cgatggagtc gggccgctcg      1680
     gcgatcgact gcgcgatgag gcaatccttc gacatcctgc tgctggactt gaggatgccc      1740
     gatctcagcg gctatgaaac ggcagtgcgg atcagggcct tgggcggatg ggcggccgac      1800
     gttcccatcg tagcggtgtc ggccaatatt gcccccgata aggcgcagat gcaggcggcg      1860
     gggatcgacg gctttcttgc caagcccttc acccctacgg cactgcgcgc gaaagtgcag      1920
     ggccacctgc atcattcggc aggtgacacc gagccggacg attctatcag ggcggatgcg      1980
     acacccgtgc tcgatgagag ctttctggcc gcccaggtca cctatgccgg accggatgcg      2040
     gttgggaagg cgattgcggg tttcctcggt aacttggacg gtcggctgtc tcgtatctgg      2100
     tccggcgccg atgcaaggga gcgcgccgat gccgcccata tgcttgccgg tgcggccggc      2160
     gcgttggggc tgctggatct ggcaacccat tgcaggcggc tcgcgagcga caggggcgac      2220
     agcccgacag cgtccttgcg gcaagaccga gacatcctgg cgtcaagtgc gggacgagct      2280
     gttgccgcct tgagggaggt cagggataaa ctcgctgccg gttcatcccg acaggactga      2340
//

If you have problems or comments...

PBIL Back to PBIL home page