(data stored in ACNUC7421 zone)

EMBL: CP000489.PE82

CP000489.PE82        Location/Qualifiers
FT   CDS_pept        77426..77737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68199"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY55"
FT                   /protein_id="ABL68199.1"
FT                   /translation="MSARSIFGLVVLQREGLMSDATIMRRRRQAPEYVATPDMAAFTIG
FT                   QIAITALREEGGLSVEILRRHLARVASGQEDAVASRVSPDMALGALRYIETSLQNKVA"
     ttgagcgcca gatcgatctt cggactggtg gttttgcaac gcgagggatt gatgagcgac        60
     gcaacgatca tgcggcgacg ccgccaagca ccggaatacg tggccacccc ggacatggca       120
     gccttcacca tcgggcagat tgccatcacc gcgttaaggg aagagggtgg gctttccgtg       180
     gaaatactgc gcaggcactt ggcccgggtc gcttccggac aagaggatgc tgtcgctagc       240
     cgcgtgagcc cggacatggc cctgggcgcg cttcgttata tcgaaacctc cttgcagaac       300
     aaggtagcct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page