(data stored in ACNUC7421 zone)

EMBL: CP000489.PE85

CP000489.PE85        Location/Qualifiers
FT   CDS_pept        79049..79255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68202"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY58"
FT                   /protein_id="ABL68202.1"
FT                   /translation="MAFGIAARVFGYPLARAEAPITIEGVSLDLNGRWIATLVNHDWSF
FT                   ESGGATTEIIAEFGADDDDAAAS"
     ttggccttcg ggatcgcggc gcgggtcttt ggctacccgc tcgcccgcgc tgaggcacct        60
     atcaccatcg agggcgtaag ccttgatttg aatggccgat ggatcgcaac ccttgttaac       120
     cacgattgga gtttcgagag cggtggcgcg acgaccgaga tcatcgccga gttcggggcg       180
     gacgacgacg atgcagcggc atcctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page