(data stored in ACNUC7421 zone)

EMBL: CP000489.PE91

CP000489.PE91        Location/Qualifiers
FT   CDS_pept        complement(83710..84885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68208"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY64"
FT                   /protein_id="ABL68208.1"
FT                   /translation="MQNSLLQLLTWTEATGRVLQHAHQVGRKHKLRAGFVSLFGYRLPD
FT                   CLPRFYCDKFGDPERFFAVQAANGYQNYFTNFSTNISERFVLRNMTRHPEARSASFPLP
FT                   QNFERYFKAHRAQAAEILAQQEAVTKVRRSTGDQKARAPEAEEAMARIAAWRARGGKVA
FT                   CAFGKVVCDSGVPFDGGPTHASMKDWINHCIRTVRGSDTLLLIKPHPHELNNQIATFPT
FT                   EFFSDLIEEEIGENVIFLGHRWFDMHDMAGLMDLGVIYNGTTSVELGIMGIPCILAGHF
FT                   APIDYPIGHIAPQTRAEFETYLRFEKPAIVAPDIRERAALWLHYMRSPDFTLPYRFHAR
FT                   PVTNKKIYPPYWFGEDLKALQTGENATPSRLARRVLGQEAEPGGQRMPSST"
     ttgcagaact cgctgttgca gcttctgacc tggaccgagg cgacgggacg cgtcctgcag        60
     catgcgcacc aagtcggaag gaagcataaa ttgcgggccg gcttcgtctc gctgttcggc       120
     tatcgcctgc ccgattgcct gccgcgcttc tattgcgaca agttcgggga tccggagcga       180
     ttcttcgcag ttcaggccgc caacggctac cagaactact tcaccaattt ctcaaccaac       240
     atttccgaac gcttcgtgct gcggaacatg acgcgccacc ccgaggcgcg ttcggccagc       300
     ttcccgctac cgcagaactt cgagcgctat ttcaaggctc atcgcgccca agccgccgaa       360
     attctcgccc agcaggaggc cgtgacgaag gttcgccgct cgaccggcga ccagaaagcc       420
     cgcgcaccgg aggccgaaga ggccatggcc cgtatcgccg cctggcgcgc ccgcggcggc       480
     aaggtcgcct gtgccttcgg caaggtggtc tgcgattctg gggtgccctt cgatggcggg       540
     ccgacccatg ccagcatgaa ggactggatc aaccattgca tccgcacggt gcgcggctcg       600
     gacacgttgt tgctgatcaa gccgcatccc catgagctga acaaccagat cgccaccttc       660
     ccgaccgaat tcttctcgga cctgatcgag gaggagatag gcgagaacgt gatctttctc       720
     ggtcatcgct ggttcgacat gcacgacatg gctgggctga tggacctggg ggtgatctac       780
     aacggcacca cctcggtcga gcttggcatc atgggcatcc cctgcatcct cgccggccat       840
     ttcgccccga tcgactatcc gatcggccat attgcgccgc agacccgtgc ggaattcgag       900
     acctatctgc gcttcgagaa gcccgccatc gttgctcccg atatccgcga gcgtgccgca       960
     ctctggctgc attacatgcg aagccccgac ttcaccctgc cctatcgctt ccatgcccgg      1020
     ccggtgacca acaagaagat ctatccaccg tattggttcg gggaggacct gaaggcgctc      1080
     caaacgggcg agaatgccac gcccagtcgt cttgcgcgta gggttctggg ccaggaggcg      1140
     gaaccggggg gacagagaat gccctcctcg acatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page