(data stored in ACNUC7421 zone)

EMBL: CP000489.PE93

CP000489.PE93        Location/Qualifiers
FT   CDS_pept        complement(86854..87855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0093"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   son:SO3271 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68210"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY66"
FT                   /protein_id="ABL68210.1"
FT                   /translation="MFDNKSILITGGTGSFGKKYVQTLLSRFKPRKIIVFSRDELKQFE
FT                   MQQKFNDPCIRYFIGDVRDRERVLQATRGVDYIIHAAALKQVPAAEYNPVECIKTNIDG
FT                   AQNVIHGAITNNVEKVIALSTDKAANPINLYGATKLASDKLFVAANNMVGERRTRFAVV
FT                   RYGNVVGSRGSVVPFFQGLIDQGAKSLPITDTDMTRFWISLQQGVDFVLKNFTRMHGGE
FT                   IFVPKIPSVRIVDLARAMAPGLEQHVIGIRPGEKLHEIMCPADDSHLAVEYDDHFVLSP
FT                   SIRFYDHDVDYFSNGIGESGKAVGRGFEYNSGTNTHFLSVDEIVEFNAKAMA"
     atgttcgaca ataaatccat cctgattaca ggcgggaccg gcagctttgg caagaagtat        60
     gtccagacgc tgctgtcgcg gttcaagccc cgaaagatca ttgtcttctc gcgcgacgaa       120
     ctgaagcagt tcgagatgca gcagaagttc aacgatccct gcatccgcta cttcatcggc       180
     gacgtgcgcg accgcgagcg ggtgctgcag gcgacgcgcg gggtggatta catcatccat       240
     gccgctgcat tgaaacaggt gccggcggcg gaatacaacc ccgtcgaatg catcaagacc       300
     aatatcgacg gggcgcaaaa cgtcatccat ggcgccatca ccaacaatgt cgagaaggtg       360
     atcgcgcttt cgaccgacaa ggcggcgaac ccgatcaacc tctatggcgc gaccaagctt       420
     gcctcggaca agctcttcgt cgccgcgaac aacatggtgg gcgaacgccg gacccgtttc       480
     gccgtggtgc gctacggcaa tgtcgtgggc tcgcgcggtt cggtcgtgcc gttcttccag       540
     gggctgatcg accagggcgc gaaaagcctg ccgatcaccg ataccgacat gacccgcttc       600
     tggatctcgc tccagcaagg ggtggatttc gtgctgaaga acttcacccg catgcatggc       660
     ggcgagatct tcgtgccgaa gatcccctcg gtgcgcatcg tcgacctggc ccgcgccatg       720
     gcgccggggc ttgaacagca tgtgatcggc atccgccccg gcgaaaagct gcacgaaatc       780
     atgtgcccgg ccgatgacag ccacctggcc gtcgaatacg atgaccattt cgtgctctcg       840
     ccctcgatcc gcttctacga tcacgacgtg gactatttct cgaacggcat cggcgagtcc       900
     ggcaaggccg tggggcgtgg cttcgaatac aattcgggca ccaacaccca cttcctgagc       960
     gtggacgaga tcgtggagtt caacgcgaag gccatggcat ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page