(data stored in ACNUC7421 zone)

EMBL: CP000489.PE95

CP000489.PE95        Location/Qualifiers
FT   CDS_pept        complement(88450..89019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0095"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: bpm:BURPS1710b_2170
FT                   DNA invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68212"
FT                   /db_xref="GOA:A1AY68"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY68"
FT                   /protein_id="ABL68212.1"
FT                   /translation="MKVGYARVSTEDQKLDLQIAALRRAGCQKIFKDRGISGSSMERPG
FT                   MKSMLRSLRPGQTLVVWRLDRLGRSLSGLVLLIEELGERGVEFQSLCESLDTASSGGRL
FT                   VFHIMAALAEFERSLISERTKAGMQEARDRGLRLGRPPSMTRDQVAEAMRESGKLPIKE
FT                   VAVRYNVSPRTLRRHLRQLRQCNELA"
     atgaaagttg gatacgcccg agtatctacg gaagaccaga agctcgacct acagatcgct        60
     gccctgcggc gggccggctg tcaaaagatc ttcaaggacc ggggaatttc cggatcttcc       120
     atggagcgac ccggcatgaa atccatgctc cgctctctcc ggcccggtca gacgctggtg       180
     gtctggcgcc tggatcggct cggccggtcc ctgtccgggc tggtcctgct catcgaagaa       240
     ttgggtgaac gaggggtgga gttccagtcc ctatgcgagt cgctggatac ggcatcgtcc       300
     ggcgggcggt tggtctttca tatcatggcc gcactcgccg aattcgaacg ctccctgatc       360
     agcgagcgca ccaaggccgg catgcaggaa gcccgggacc gaggccttcg tctcggacgt       420
     ccaccgtcga tgacccggga ccaggtggcc gaggccatgc gagaatccgg caaactcccg       480
     atcaaagaag tagcggtaag atacaatgtc tcaccccgaa ctctgcggcg tcatcttcgg       540
     cagttgaggc aatgcaacga gttggcttga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page