(data stored in ACNUC7421 zone)

EMBL: CP000489.PE99

CP000489.PE99        Location/Qualifiers
FT   CDS_pept        complement(90690..91028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68216"
FT                   /db_xref="GOA:A1AY72"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY72"
FT                   /protein_id="ABL68216.1"
FT                   /translation="MEDAMRKPRDYDAELKALEDKARELKTRKVQQLGELVIATGADAL
FT                   TADELAGALVVLAETTDAGKRDAWAKRGVAFFRGKSRRSAPTPDRNAGSAQTQPGGAQS
FT                   AASGAGAA"
     atggaggatg caatgcgcaa gccacgcgac tacgatgccg agctaaaggc tctggaagac        60
     aaggcgcggg aactcaaaac ccgcaaggtg cagcaactcg gcgaactggt gatcgccacc       120
     ggggcggatg cactgaccgc cgacgaattg gccggggcgc tggtggttct ggcggaaacg       180
     accgatgccg gaaagaggga cgcatgggcc aagcgcgggg tcgcgttctt tcgtgggaaa       240
     tcacggcgat ctgcaccaac gcctgaccgc aacgcaggca gcgctcaaac gcaaccgggc       300
     ggcgcacaat cggcggcaag cggcgcgggc gcggcatga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page