(data stored in ACNUC1104 zone)

EMBL: CP000509.PE103

CP000509.PE103       Location/Qualifiers
FT   CDS_pept        complement(120754..121770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0108"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dge:Dgeo_2864 alcohol dehydrogenase GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79653"
FT                   /db_xref="GOA:A1SCW8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW8"
FT                   /protein_id="ABL79653.1"
FT                   /translation="MPVAARLHSVGDLRVEQVAEPPAPTVGWSTVAVTSVGLCGSDLHW
FT                   FTDGGTGEVTLDRPVVPGHELAGRALDGPYAGRRVAIDPAIPCGVCEQCRAGHGNLCPD
FT                   VRFAGHAGLDGGLQERLVWPDHLLFPLPDDLSDDAGALLEPLGVAIHAVGVAHVRPGHD
FT                   VLVVGGGPIGVLTAAVARRTGAAQVVVSEPLAHRRETARRFGADVAVAPEEASSAVDEL
FT                   TGGRGVDVVIEMAGADDAIGTAVACARPGARIALGGIPSVPLSSFPAAPARRKGLTFAM
FT                   VRRMHETYPRAIELATSGIDLDALVSDRFPLADAPLAFTHAVARTGDKTVIAVSGTR"
     gtgcccgtcg ccgcccggct ccactccgtc ggcgacctgc gggtcgagca ggtcgccgag        60
     ccgcccgctc ccaccgtcgg ctggtcgacc gtcgcggtca cctcggtcgg gctctgcggc       120
     tccgacctgc actggttcac cgacggcggc accggcgagg tcacgctcga ccgaccggtg       180
     gtcccgggcc acgagctcgc cgggcgcgca ctggacgggc cgtacgccgg gcgccgggtc       240
     gcgatcgacc ccgcgatccc gtgcggggtc tgcgagcagt gccgcgccgg gcacgggaac       300
     ctgtgtcccg acgtgcgctt cgccgggcac gccggcctgg acggcggcct ccaggagcgg       360
     ctggtctggc ccgaccacct gctgttcccg ctcccggacg acctcagcga cgatgcgggc       420
     gcgctgctcg agccgctcgg ggtcgcgatc cacgcggtcg gggtggcgca cgtccgcccc       480
     ggccacgacg tactggtggt gggcggcggc ccgatcgggg tgctcactgc cgcggtggct       540
     cgccgtaccg gcgccgccca ggtggtcgtg agcgagccgc tcgcgcaccg gcgcgagacc       600
     gcacgccgct tcggcgccga cgtcgcggtc gcaccggagg aggcctcgtc cgcggtcgac       660
     gagctgaccg gcgggcgcgg cgtcgacgtg gtcatcgaga tggcgggggc ggacgacgcc       720
     atcggcaccg ccgtcgcctg cgcgcgcccg ggcgcccgga tcgcgctggg cggcatcccg       780
     tcggtgccgc tgtcctcgtt ccccgccgca cccgcccggc gcaagggcct gaccttcgcg       840
     atggtccgcc ggatgcacga gacctacccg cgcgcgatcg agctcgccac gagcggcatc       900
     gacctcgacg ccctggtcag cgaccgcttc ccgctcgccg acgcacccct cgccttcacc       960
     cacgccgtcg cccgcaccgg cgacaagacc gtcatcgcgg tgtccggcac ccgttga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page