(data stored in SCRATCH zone)

EMBL: CP000509.PE104

CP000509.PE104       Location/Qualifiers
FT   CDS_pept        121874..124267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO1740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79654"
FT                   /db_xref="GOA:A1SCW9"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW9"
FT                   /protein_id="ABL79654.1"
FT                   /translation="MAPRLVRPDPRAGRSRPRAWSLPRPPARRPRGPADRVARSRDSGE
FT                   PAAATRQTGTVDRPTLRRLFPRRVAIVCAAVLVVQGVGLALLVRDVREPRPHQVPVAVV
FT                   GPAVVAQGLAEQVNALEGRPLDVTASADREAAVDDVRHGLTVGAALIDLTGTQDQVVLD
FT                   GSTDERLARAVVEQARAIERSHGRTLSVRRVSMSDVDDDVVRGLAVGFGAVGFVVALAL
FT                   SLRFGPTARTLRLGTRRVLVVAAISLVSGYAATLLPGVSTLDTGAQLRLAGVLALTAAV
FT                   AGTVTLALEGVAGFGGLGLSAVFYLVVATPQLLGTDPHLLPAPWPVLSQWLPPGASVEA
FT                   LGAIALYGGTGIRLPLLVLAVWLLAAVLALQVSRRERVREQTAPDAGLDEPLLLHPPLT
FT                   PVVRHGRLVRWRWRVGVVVLPAAGAAFVLVSFVPRDAVADVAPVASRASETECVSTGTV
FT                   RSVADLNRMVRTVRGGPEFQGGDVGADTELQDGRRVMVFGDTLRSPSFAGQRFVRNSML
FT                   LIGGECIQAVVPEDHGALIPDRPSAQSAGRVGYWPMSAVTITHPGYDLVVVTAQRVRST
FT                   GIDDAFGFESLGPAVAVFVVPRGETPQLVAVRDVGPDAADVTRPEWGAAAVVEGEWLYL
FT                   YGTANPDQPYVFGFSLRVARVHPDDVLRPAAWEYWSGTDWVADPAQSRELIPAAGGTSQ
FT                   TLSVFRDGGQWHALSKRNEFLGSDVVVWTAPDPWGPFDGGRTVAPLPSDAAQGRLRYLP
FT                   LAHPGLLPEPGTVVVSFSRNRTDVDEVVADPTRYRPGFLRVDLP"
     gtggcgcctc ggttggtacg cccggacccc cgggccgggc gttcccgacc gcgagcctgg        60
     agcctcccgc ggccaccggc ccggcgccct cgcggcccgg ctgaccgggt ggcccggtcg       120
     cgggattccg gtgagccggc cgccgcgacc cgccagactg ggaccgtgga ccgtccgacc       180
     ctgcgccggc tgttcccgcg ccgggtcgcg atcgtgtgcg cggcggtcct ggtcgtccag       240
     ggagtcgggc tcgcgctgct ggtccgcgac gtccgcgagc cacgcccgca ccaggtgccg       300
     gtcgccgtcg tcggaccggc cgtcgtcgcc cagggcctgg cggagcaggt caacgcgctc       360
     gagggccggc cgctcgacgt caccgcgagc gcggatcggg aagcggccgt cgacgacgta       420
     cggcacggcc tcaccgtcgg cgccgcgctc atcgatctca cgggcaccca ggaccaggtg       480
     gtcctcgacg gctcgaccga cgaacggctc gcccgggccg tggtggagca ggcccgggcg       540
     atcgagcgct cgcacggccg cacgctgtcg gtccgccgcg tctcgatgtc cgacgtcgac       600
     gacgacgtcg tccgcggcct ggcggtcggc ttcggcgcgg tgggcttcgt ggtggcgctg       660
     gcgctctcgc tgcgcttcgg gccgaccgcg cgcaccctcc ggctgggaac ccggcgggtg       720
     ctggtggtcg cggcgatctc cctggtgagc gggtacgccg ccacgctgct gcccggcgtg       780
     agcaccctcg acaccggtgc ccagctgcgc ctcgcgggag tcctggccct gaccgcggcg       840
     gtcgccggga cggtcacgct cgccctggag ggcgtggccg ggttcggcgg cctgggcctg       900
     agcgcggtct tctacctggt ggtggcgacg ccgcagctgc tcggcaccga cccgcacctg       960
     ctcccggcgc cgtggccggt gctctcgcag tggctcccgc cgggggcgag cgtcgaggcg      1020
     ctcggcgcga tcgcgctgta cggcggcacc ggcatccggc tgcccctgct ggtgctcgcc      1080
     gtgtggctgc tggccgccgt cctcgcgctg caggtctcgc gccgggagcg ggtccgcgag      1140
     cagaccgcgc ccgacgccgg cctggacgag ccgctgctgc tgcacccgcc gctgacgccg      1200
     gtggtgcggc acggccggct ggtgcgctgg cgctggcggg tcggggtcgt ggtgctgccg      1260
     gccgccgggg cggcgttcgt cctggtgtcg ttcgtcccgc gtgacgccgt cgcggacgtc      1320
     gcgccggtcg ccagccgcgc cagcgagacc gagtgcgtct cgaccggcac ggtccgcagc      1380
     gtggcggacc tcaaccggat ggtgcgcacg gtgcgcggcg gcccggagtt ccagggcggt      1440
     gacgtcggtg ccgacaccga gctgcaggac ggccggcggg tgatggtctt cggcgacacg      1500
     ctgcgcagcc cgtccttcgc cggccaacgc ttcgtgcgca actcgatgct gctcatcggc      1560
     ggcgagtgca tccaggccgt cgtgcccgag gaccacgggg cgctgatccc ggaccggccg      1620
     agcgcgcagt ccgccggccg ggtcggctac tggccgatgt ccgcggtgac gatcacccat      1680
     ccgggctacg acctggtcgt ggtgaccgcg cagcgggtgc ggagcaccgg catcgacgac      1740
     gcgttcggct tcgagagcct cgggcccgcg gtcgcggtct tcgtggtccc ccggggcgag      1800
     accccgcagc tggtcgcggt acgcgacgtc gggccggacg ccgccgatgt cacccgcccg      1860
     gagtggggcg cggcggctgt ggtcgagggc gaatggctct acctctacgg caccgcgaac      1920
     ccggaccagc cctacgtctt cggcttctcg ctgcgggtcg cgcgggtgca cccggacgac      1980
     gtgctgcggc ccgctgcctg ggagtactgg tcgggcaccg actgggtcgc agacccggcg      2040
     cagagccggg agctgatccc ggccgcgggc gggacgtcgc agacgctctc ggtgttccgc      2100
     gacggtgggc agtggcacgc gctgagcaag cgcaacgagt tcctcggcag cgacgtggtc      2160
     gtgtggaccg cgccggaccc gtggggcccg ttcgacggcg ggcgcaccgt cgccccgctg      2220
     ccctcggacg ccgcccaggg gcggctgcgg tacctgccgc tcgcgcaccc ggggctgctg      2280
     cccgagcccg gcaccgtcgt ggtctcgttc agccgcaacc gcaccgacgt cgacgaggtg      2340
     gtcgcggacc cgacccgcta ccggccgggc ttcctcaggg tggacctgcc gtag            2394
//

If you have problems or comments...

PBIL Back to PBIL home page