(data stored in ACNUC1104 zone)

EMBL: CP000509.PE106

CP000509.PE106       Location/Qualifiers
FT   CDS_pept        complement(124963..125349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79656"
FT                   /db_xref="GOA:A1SCX1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX1"
FT                   /protein_id="ABL79656.1"
FT                   /translation="MGGHYPDPQPRMCSRTPLRRRDVVQATPPPRFRQGRRGKRDPQTA
FT                   PTGGPMTITALLMAGLMAFVLLVPTLMVAILVSGIARRPEPAEAAPVTGQATGPVTGPV
FT                   AVPVAVPVGARATVTRPTVELRAS"
     atgggtggcc actacccaga tcctcagccg cggatgtgct cccggacgcc gctccggcgg        60
     cgcgatgtcg tccaggccac acccccgccg aggtttcggc aggggcgccg cgggaaacga       120
     gacccgcaga ccgcacccac cggaggaccc atgacgatca ccgcgctgct gatggcaggc       180
     ctgatggcct tcgtgctgct ggtgcccacc ctgatggtcg cgatcctcgt gtccggcatc       240
     gcccgtcgcc ccgagcctgc cgaggccgcc ccggtgactg ggcaggccac tgggccggtc       300
     actgggccgg tcgccgttcc ggtggccgtc cccgtcggtg cacgggccac cgtgacgcgg       360
     ccgaccgtcg agctccgggc ctcctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page