(data stored in SCRATCH zone)

EMBL: CP000509.PE109

CP000509.PE109       Location/Qualifiers
FT   CDS_pept        complement(127444..129465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0114"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mmc:Mmcs_0519 MmpL"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79659"
FT                   /db_xref="GOA:A1SCX4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX4"
FT                   /protein_id="ABL79659.1"
FT                   /translation="MPRILTEAHMTSLITGRRSAWVLALVPFFLALVLIGAVGEGDRAS
FT                   RSTDALPAGLDSTEGTALLDRLPEAASSAAIVLFTADRGELSRDQLAALRDAGAGLADG
FT                   GSPLVLAEDGTAALLAVPVPAGSAGEVADRVSALRAAADDAAPDGVQAQVTGPAAVQAD
FT                   LAAVFDGANTRLLLVTALVVAVLLVITYRSPVLWLVPLVVVGVADRLAAVLATQVMARV
FT                   DVAWDESTVGILSVLVFGTGTDYALLLISRYRDELRTEPSRRRAMAHALRRTAEAVLAS
FT                   ATTVVLGLLTLLLSLTPTTRGLGLACAVGVVVAAAFALVVLPAALVLFGRWVFWPRVPH
FT                   VGEAVTVEADTVWHRIGARVARRPALVAGGSLVLLALMATGIGRIHLGLDQAEQFLDEP
FT                   EAISAATRLAESFPAGTADPTQVVTEGSGDAVLRAVRSVDGVTSARVSATGGGVVVVDA
FT                   VLSGRSGENADVVTALREAVAPYDAHVTGAEAKALDEREGSDRDLRLIVPLILVLVLGG
FT                   LVVLLRSVVAPLLLVVTVVATYAAAMGASWWLFTGPLGFGAMDSGVPLFAFLFLVALGV
FT                   DYNIFLVTRAREEAAGHGSRGGMLRALSATGGVITSAGILLAAVFAVLGVLPLVVLAQL
FT                   GTIICLGVLLDTLLVRTLVVPALALVLGDRFWWPRRVA"
     atgccacgga tcctcacgga ggcccacatg acctcgctga tcaccggccg gcgcagcgcc        60
     tgggtgctcg ccctcgtgcc attcttcctg gccctggtcc tgatcggcgc cgtcggtgag       120
     ggcgaccgcg cgtcgcgcag caccgatgcc ctgcccgccg ggctggacag caccgagggg       180
     accgcgctcc tggaccggct ccccgaagcc gcgtcgagcg ccgcgatcgt gctgttcacg       240
     gccgatcgcg gtgagctctc ccgcgaccag ctggccgcgc tgcgggacgc gggagcgggt       300
     ctggccgatg gcggcagccc cctggtgctc gccgaggacg gcaccgctgc cctgctcgcc       360
     gtgccggtcc cggccggctc ggccggcgag gtggccgacc gggtgagcgc gctgcgcgcc       420
     gccgccgacg acgccgcgcc tgacggcgtg caggcccagg tcaccggccc ggccgcggtc       480
     caggccgacc tcgccgcggt cttcgacggg gcgaacaccc gcttgctgct ggtcaccgcg       540
     ctcgtggtcg ccgtgctgct cgtgatcacc taccgcagcc ccgtgctgtg gctggtcccg       600
     ctggtcgtcg tgggcgtcgc cgatcggctc gccgcggtcc tggcgaccca ggtgatggcc       660
     cgcgtcgacg tcgcgtggga cgagtccacg gtcgggatcc tctcggtgct ggtcttcggc       720
     accggcaccg actacgcgct gctgctgatc tcccgctacc gcgacgagct gcgcaccgag       780
     ccgtcgcggc gccgggcgat ggcgcacgcg ctgcggcgta cggcggaggc ggtgctggcc       840
     agcgcgacca ccgtcgtcct ggggctgctg accctgctgc tctcgctgac cccgaccacc       900
     cgcggcctcg gcctcgcgtg cgcggtcggc gtcgtggtcg ccgctgcgtt cgcgctggtg       960
     gtgctcccgg cggcgctcgt gctgttcggg cgctgggtgt tctggccgcg ggtgccgcac      1020
     gtcggtgagg cggtcacggt cgaggccgac accgtgtggc accggatcgg ggcgcgggtg      1080
     gcgcgccggc cggccctggt ggccggcggc tccctggtgc tgctcgccct gatggcgacc      1140
     gggatcgggc ggatccacct cggcctggac caggccgagc agttcctcga cgagccggag      1200
     gcgatcagcg ccgccacccg gctggccgag tccttccccg ccggcaccgc cgacccgacc      1260
     caggtcgtca ccgagggctc cggcgacgcc gtgctccggg cggtccgctc ggtcgacggc      1320
     gtgacctcgg cccgggtctc ggccaccggc ggcggcgtgg tcgtggtcga cgcggtgctg      1380
     tccggccgct ccggggagaa cgccgacgtc gtgaccgcac tgcgcgaggc ggtcgcgccg      1440
     tacgacgcgc acgtgaccgg cgccgaggcg aaggccctcg acgagcgcga ggggtcggac      1500
     cgcgacctgc ggctgatcgt gccgctgatc ctggtgctgg tgctcggcgg gctggtggtg      1560
     ctgctgcgct ccgtcgtcgc gccgctgctg ctcgtggtga ccgtggtcgc gacgtacgcc      1620
     gcggcgatgg gcgcctcgtg gtggctgttc acggggccgc tcgggttcgg cgcgatggac      1680
     agcggcgtgc cgctgttcgc gttcctgttc ctcgtcgcgc tcggcgtcga ctacaacatc      1740
     ttcctggtca cccgcgcccg tgaggaggcc gccggccacg ggtcgcgcgg cggcatgctg      1800
     cgggcgctgt cggcgaccgg cggggtgatc accagtgctg gcatcctgct cgcggcggtg      1860
     ttcgcggtgc tgggggtgct gccgctggtg gtgctcgccc agctcggcac gatcatctgc      1920
     ctgggcgtgc tgctcgacac gctcctggtc cgcaccctgg tggtgccggc gctcgccctg      1980
     gtcctcggcg accggttctg gtggccgcgc cgggtcgcct ga                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page