(data stored in ACNUC1104 zone)

EMBL: CP000509.PE110

CP000509.PE110       Location/Qualifiers
FT   CDS_pept        129511..130020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0115"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: rxy:Rxyl_1740
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79660"
FT                   /db_xref="GOA:A1SCX5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX5"
FT                   /protein_id="ABL79660.1"
FT                   /translation="MAKPERAGPASEFADAWRQTGSLVALREAIEAGARVRHVVARRAG
FT                   LSDSELVALQHLVRTSLGPAELARILDISTAASTGVVDRLAERGHVERHPHAEDRRRTD
FT                   VRVTASGREEVLAHLLPMFTALDAWDRSFTEAERALVERYLRGVRAAFEQVFDPPVIAQ
FT                   PPPSEA"
     atggcgaagc ccgagcgggc cggcccggcg agcgagttcg ccgatgcctg gcgtcagacc        60
     gggagcctgg tcgccctgcg cgaggcgatc gaggcgggtg cccgggtgcg ccacgtggtc       120
     gcccggcgcg cggggctgag cgactccgag ctggtcgcgc tccagcacct ggtccggacc       180
     tcgctaggcc ccgcggagct ggcccggatc ctcgacatca gcaccgccgc gtcgaccgga       240
     gtcgtcgacc ggctcgccga gcgggggcac gtcgagcggc acccgcacgc cgaggaccgc       300
     cgtcgcacgg acgtgcgggt gaccgcgtcc gggcgcgagg aggtgctcgc gcacctgctg       360
     ccgatgttca ccgccctgga cgcctgggac cgctcgttca ccgaagccga gcgcgcgctg       420
     gtcgagcggt acctgcgggg cgtccgggcg gccttcgaac aggtcttcga cccgccggtg       480
     atcgctcagc cgccaccctc ggaggcgtag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page