(data stored in ACNUC1104 zone)

EMBL: CP000509.PE111

CP000509.PE111       Location/Qualifiers
FT   CDS_pept        complement(129996..130754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0116"
FT                   /product="Polyphosphate glucokinase"
FT                   /EC_number="2.7.1.63"
FT                   /note="PFAM: ROK family protein; KEGG: lxx:Lxx09960
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79661"
FT                   /db_xref="GOA:A1SCX6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX6"
FT                   /protein_id="ABL79661.1"
FT                   /translation="MAQTAPQPFGIDFGGTGIKGAPVDLEAGDFAAERVRIRTPDPSTP
FT                   ERVAAVFVELLRRFPDSTGAVGVTVPGVVRHGVVRSAANIDRAWVGTDADRLFTRATGR
FT                   EVHVVNDADGAGLAEVRYGAAKGRSGLVIVTTLGTGIGSAMVYDGVLVPNSELGHLEVE
FT                   GHDAESRAANSAREREDLSWEQWAKRLTTYYRTLERLFSPELFVVGGGVSKSSAEFLAL
FT                   VDIDTEIIPAALLNKAGVVGAALYASEGGG"
     atggcccaga cggcaccgca gcccttcggc atcgacttcg gtggcaccgg catcaagggc        60
     gcaccggtcg acctcgaggc cggcgacttc gccgccgagc gggtccggat ccggaccccc       120
     gacccgtcca cacccgagcg ggtggcggcg gtcttcgtcg agctgctgcg ccgattcccg       180
     gactccaccg gcgcggtcgg cgtgacggtc cccggggtgg tccgccacgg cgtggtccgc       240
     tcggcggcca acatcgacag ggcctgggtc ggcaccgacg ccgaccggct cttcacccgg       300
     gccaccggcc gcgaggtgca cgtcgtgaac gacgcggacg gcgccgggct ggccgaggtg       360
     cggtacggcg cggcgaaggg ccgctccggc ctggtgatcg tgaccaccct cggcaccggg       420
     atcggctcgg cgatggtcta cgacggcgtc ctggtgccga actccgagct cggccacctc       480
     gaggtcgagg gccacgacgc cgagtcccgg gcggccaaca gcgcccgcga gcgcgaggac       540
     ctgtcctggg agcagtgggc gaagcggctc acgacgtact accgcaccct ggagcggctc       600
     ttctctcccg agctgttcgt ggtcggcggc ggggtcagca agtcctccgc cgagttcctc       660
     gcgctggtgg acatcgacac cgagatcatc ccggcggcgc tgctcaacaa ggccggggtg       720
     gtgggcgcgg cgctctacgc ctccgagggt ggcggctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page