(data stored in SCRATCH zone)

EMBL: CP000509.PE112

CP000509.PE112       Location/Qualifiers
FT   CDS_pept        130799..131413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0117"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: nfa:nfa31300 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79662"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX7"
FT                   /protein_id="ABL79662.1"
FT                   /translation="MLLLGAVALFEPVNGYQIRRELLSWQVDRWAHTNPGSIYHGLTSL
FT                   TGLGHLVRHDLVDGGREVAVYELTGSGRAELERLMVEALETVNPYERSAFTVAFSMLPL
FT                   LDRDRVLRSLTRRRVDLEQTVAELAAANPGVAPPHATRSMLLWLDLAVAELAWLRETIE
FT                   DIRAGKLPFEMDDDWGWTPPADDPGWQMSTDREKYRALLGR"
     atgctgttgc tgggtgcggt ggcgctcttc gagccggtca acggctacca gatccgccgg        60
     gagctgctgt cctggcaggt ggaccggtgg gcgcacacca acccgggctc gatctaccac       120
     ggcctgacgt cgctgaccgg gctcggccac ctggtccgcc acgacctcgt ggacgggggc       180
     cgcgaggtcg cggtctacga gctgaccggg agcggccggg ccgagctgga gcgactgatg       240
     gtcgaggcgc tggagaccgt caacccctat gagcgcagcg cgttcacggt cgcgttctcg       300
     atgctgccgc tcctcgaccg cgaccgggtg ctgcggagcc tgacccggcg gcgcgtggac       360
     ctggagcaga cggtggccga gctcgcggca gcgaacccgg gcgtcgcccc gccgcacgcg       420
     acccggagca tgctgctctg gctcgacctc gcggtcgccg agctcgcgtg gctgcgcgag       480
     accatcgagg acatccgcgc gggcaagctg cccttcgaga tggacgacga ctggggctgg       540
     accccgcccg ccgacgaccc gggctggcag atgagcaccg accgggagaa gtaccgcgcg       600
     ctactcggtc gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page