(data stored in SCRATCH zone)

EMBL: CP000509.PE113

CP000509.PE113       Location/Qualifiers
FT   CDS_pept        complement(131399..132259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0118"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   dvu:DVU0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79663"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX8"
FT                   /protein_id="ABL79663.1"
FT                   /translation="MTEPADVRLAVLIDADNVSASHAADLLAELARYGVPTVKRAYGDW
FT                   TTQQLAGWKSELARHAIQPIQQFANTVGKNSTDSALIIDAMDLLYSGHLDAFAIVSSDS
FT                   DFTRLATRLRESGKTVYGLGRRRTPASLQAACDKFIFLEVLRDGEGGGADQAHQKEAAP
FT                   GSEHEADADAEADSLPDLRTILEAAVRSTAQDDGWSALGSVGSYLGKTHAAFDPRHYGF
FT                   PRLSALAGAQPYLDLDHPDGGQPRVRLRSQRPPRKRAAAKKAGSQNEPAKKTTKKGAAR
FT                   DSATE"
     gtgaccgaac ccgccgacgt gcgcctggcc gtgctcatcg acgccgacaa cgtgtccgcc        60
     tcgcacgcgg cggacctgct cgccgagctg gcgcgctacg gcgtccccac cgtcaagcgg       120
     gcgtacggcg actggacgac ccaacagctg gccggctgga agtccgagct ggcccgccac       180
     gcgatccagc cgatccagca gttcgcgaac acggtcggca agaactccac cgactccgcg       240
     ttgatcatcg acgcgatgga cctgctctac tccggccacc tcgacgcgtt cgcgatcgtc       300
     tcgagcgaca gcgacttcac ccggctcgcg acccggctgc gggagtcggg caagaccgtc       360
     tacggcctgg ggcgccggcg tacgccggcc tcgctgcagg cggcctgcga caagttcatc       420
     ttcctcgagg tgctgcgcga cggcgaagga ggcggcgccg accaggcgca ccagaaggag       480
     gcggcccccg ggtccgagca cgaggccgac gccgacgccg aggccgactc gctgccggac       540
     ctgcgcacga tcctggaggc cgcggtgcgc agcaccgcgc aggacgacgg ctggtccgcg       600
     ctcgggtcgg tcggcagcta cctgggcaag acccacgcgg cgttcgaccc gcgccactac       660
     gggttcccgc ggctcagtgc gctcgccggt gcgcagccct acctcgacct cgaccatccc       720
     gacggcggcc agccgcgggt ccggctgcgc agccaacggc caccgcgcaa gcgggcggcc       780
     gccaagaagg ccggctcaca gaacgaaccg gcgaagaaga cgacgaagaa gggtgcggcg       840
     cgggactcag cgaccgagta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page