(data stored in ACNUC1104 zone)

EMBL: CP000509.PE114

CP000509.PE114       Location/Qualifiers
FT   CDS_pept        132342..133082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0119"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   sco:SCO1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79664"
FT                   /db_xref="GOA:A1SCX9"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX9"
FT                   /protein_id="ABL79664.1"
FT                   /translation="MSRHLDAIRSAMVAFVRYAERAGLGAPVPTCPDWTVRDLVAHQGM
FT                   VHRWATALVRGEHDVDPDAFEAAGRAAADPLEWLRDGAVALADELTRAPADLHALVFLH
FT                   DAPAPREFWARRQCHETTVHGVDALAAALGRWPTAEDTWIEPDLAVDGIDELPGGFLTR
FT                   PRSRLRCEEEALLVVAPDDAPDRWLVHLGPGPAVTERRVGPVFADADWQLDGSAVSLYL
FT                   ALWNRTRRPGLDAGWRDRAAVTWG"
     atgtcgcgtc atctcgacgc gatccgctcc gcgatggtgg ccttcgtccg gtacgccgag        60
     cgcgccggac tcggcgcgcc cgtgccgacc tgccccgact ggacggtccg ggacctggtc       120
     gcccaccagg gcatggtgca ccgctgggcg acggccctcg tgcgcggcga gcacgacgtc       180
     gacccggacg cgttcgaggc cgccggccgg gccgcggcgg acccgctgga gtggctgcgc       240
     gacggcgcgg tcgcgctcgc cgacgagctc acccgcgcgc ccgccgacct gcacgccctg       300
     gtgttcctcc acgacgcccc cgcgccgcgg gagttctggg cgcgccggca gtgccacgag       360
     acgacggtgc acggcgtcga cgcgctcgcg gcggcgctcg gccgctggcc gacggcggag       420
     gacacctgga tcgagccgga cctcgcggtc gacgggatcg acgagctgcc gggcgggttc       480
     ctgacccgtc cgcgctcgcg gctgcgctgc gaggaggagg cgctgctcgt ggtcgcgccc       540
     gacgacgccc ccgaccgctg gctggtccac ctcggccccg ggccggccgt caccgagcgg       600
     cgggtcggtc cggtgttcgc cgacgcggac tggcagctcg acggctcggc ggtctcgctg       660
     tacctggcgc tctggaaccg gacccggcgg cccggcctgg acgccggctg gcgcgatcgc       720
     gcggcggtga cctggggctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page