(data stored in SCRATCH zone)

EMBL: CP000509.PE118

CP000509.PE118       Location/Qualifiers
FT   CDS_pept        136857..137420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0123"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_3220
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79668"
FT                   /db_xref="GOA:A1SCY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY3"
FT                   /protein_id="ABL79668.1"
FT                   /translation="MPGTTRSRIVDAAVAMTVESGWARVTMGALAERVGVSRQTVYNEV
FT                   GTKPGLAEAMIHQELDRFLGVVSEAFDRHPDDLVDAIRAASSGVLELAQDNRLLHAVVS
FT                   ATHGADTELLPLLTTHAESLLAAAKLVVADRLAPYSLGIEGRRLAAAIDVVVRVVLSHV
FT                   MQPSGSPADTADDIAWIAARVLRG"
     gtgcctggga ccacgcgctc gcggatcgtg gacgcggcgg tcgccatgac cgtcgagtcc        60
     ggctgggcac gggtcacgat gggcgccctc gccgagcggg tgggggtcag ccggcagacc       120
     gtctacaacg aggtcggcac caagcccggg ctggccgagg cgatgatcca ccaggagctg       180
     gaccgcttcc tcggcgtcgt ctcggaggcc ttcgaccggc acccggacga cctggtcgac       240
     gcgatccgcg ccgcctcctc gggcgtgctc gagctggccc aggacaacag gctgctgcac       300
     gcggtcgtct ccgcgacgca cggcgcggac accgagctgc tgccgctgct gaccacgcat       360
     gccgagtcgc tgctggcggc cgcgaagctg gtcgtcgcgg accggcttgc gccgtactcc       420
     ctcgggatcg agggccggcg cctggcggcg gccatcgacg tggtggtccg ggtcgtgctc       480
     agccacgtga tgcagccctc cgggtccccg gccgacaccg ccgacgacat cgcctggatc       540
     gccgcccggg tgctgcgcgg gtag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page