(data stored in ACNUC1104 zone)

EMBL: CP000509.PE119

CP000509.PE119       Location/Qualifiers
FT   CDS_pept        137752..139167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0124"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV4524 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79669"
FT                   /db_xref="GOA:A1SCY4"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY4"
FT                   /protein_id="ABL79669.1"
FT                   /translation="MAGPDGVRLGTATGRAVVLAAVLGSGMTMLDGTVVNVALRTIGAD
FT                   LDASLPELQWITNGYLLSMASLILLGGSLGDRFGRRRVFVVGTVWFAVASLACGSAPTP
FT                   EVLIVARILQGVGAALLTPGSLAMIQGAFVRDDRAQAIGSWSGLTSIAAAVGPLVGGAL
FT                   VQYASWRWIFLVNLPIATLTVVVARRAVPETRDPNAPRRFDALGAVLAALALGGLTYAL
FT                   IEWGGALAPWAVVVTVLAAAAYLVDERRSDHPMLPLGIFADRTFTAANAMTMVVYAALG
FT                   AVLFFLVLQLQTVSGYGALGAGLATLPITFCMLLLASQGGRLGARIGPRVPMSLGPLVM
FT                   AAGTLLLLRVGAGTTYWTDVLPGLVVFGLGLALLVAPLTATVLAAVADEHAGIASGVNN
FT                   AVARAGSLLAVAALPAAVGLRGEEYADPVAFDAAYGSAILACAALLALGGVVSWLSIRD
FT                   PGIGRTAAPPIGR"
     ttggccggac ccgatggcgt ccggctcggt acggcgaccg gccgcgccgt cgtcctcgcg        60
     gcggtcctcg gctcggggat gacgatgctc gacggcaccg tcgtgaacgt cgcgctgcgc       120
     acgatcggcg cggacctgga cgcctcgctc cccgagctgc agtggatcac caacggctac       180
     ctgctctcga tggccagcct gatcctgctg ggcgggtcgc tgggcgaccg gttcggccgg       240
     cgccgggtgt tcgtggtggg cacggtgtgg ttcgccgtcg cctcgctcgc gtgcggctcg       300
     gcgccgacgc cggaggtcct gatcgtcgcg cggatcctcc agggcgtcgg cgcggccctg       360
     ctcacgccgg gcagcctcgc gatgatccag ggtgccttcg tccgcgacga ccgggcccag       420
     gcgatcggct cctggtccgg gttgacgagc atcgcggccg ccgtcgggcc gctcgtcggc       480
     ggcgcactgg tgcagtacgc cagctggcgc tggatcttcc tggtcaacct gccgatcgcg       540
     acgctcaccg tcgtcgtcgc ccgccgcgcg gtcccggaga cgcgggaccc gaacgccccc       600
     cggcgcttcg acgccctcgg cgcggtgctg gccgcgctcg ccctcggcgg cctgacctac       660
     gcgctgatcg agtggggtgg cgccctcgcg ccctgggccg tggtcgtcac cgtcctcgcg       720
     gctgcggcgt acctcgtcga cgagcgccgc agcgaccacc cgatgctgcc gctcggcatc       780
     ttcgccgacc gcaccttcac cgccgccaac gcgatgacga tggtcgtcta cgccgcgctc       840
     ggtgccgtgt tgttcttcct cgtcctgcag ctgcagacgg tgagcgggta cggcgcgctc       900
     ggcgccggcc tggccactct gccgatcacg ttctgcatgc tgctgctcgc ctcgcagggc       960
     ggccggctgg gcgcccggat cggccctcgc gtcccgatga gcctcggccc gctggtgatg      1020
     gccgcgggca ccctgctgct gctgcgcgtc ggcgccggga cgacgtactg gaccgacgtg      1080
     ctgcccgggc tggtcgtctt cgggctgggg ctggcactgc tggtcgcgcc gctgaccgcc      1140
     accgtcctgg ccgccgtggc cgacgagcac gccgggatcg ccagcggcgt caacaacgcg      1200
     gtcgcccgcg ccggctcgct gctggcggtg gccgcgctcc cggccgcggt cgggctgcgc      1260
     ggcgaggagt acgccgaccc ggtggcgttc gacgccgcct acggctcggc gatcctcgcg      1320
     tgcgccgcgc tgctcgcgct gggcggcgtc gtctcgtggc tgagcatccg cgacccgggc      1380
     atcggccgga ccgccgcgcc accgatcgga aggtag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page