(data stored in ACNUC1104 zone)

EMBL: CP000509.PE127

CP000509.PE127       Location/Qualifiers
FT   CDS_pept        complement(145778..146350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79677"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ2"
FT                   /protein_id="ABL79677.1"
FT                   /translation="MSNHRTLAFAAVASLATLGLVGGATTTSSADADGFAPHVGQRVAA
FT                   KATAPVKCGGGALKKMTSRLSAEPFSFAGTAGADVAVTGAQVALTGPPKGTDTVLVTFT
FT                   AESYYTGSGWMSLELHKDGVPAAPYADNGSPFAFTSEASYHGDSAQFCTKIGTGTHVLA
FT                   IQASTTGNSSTDSGWIDDWTMSVPRFE"
     atgagcaacc accgcaccct cgccttcgcc gccgtcgcca gcctcgccac cctcggactg        60
     gtcggaggcg ccaccacgac cagctcggcc gacgccgacg ggttcgctcc ccacgtcggc       120
     cagcgggtgg ccgccaaggc cacggcgccg gtcaagtgcg gcggtggcgc cctgaagaag       180
     atgaccagcc ggctctcggc cgagccgttc tcgttcgccg gcaccgccgg ggccgacgtg       240
     gcggtcaccg gcgcccaggt cgcgctcacc ggtccgccga aggggaccga caccgtcctg       300
     gtcacgttca ccgcggagag ctactacacc ggcagcggtt ggatgagcct ggagctgcac       360
     aaggacggcg tgccggccgc gccgtacgcc gacaacggca gcccgttcgc gttcacctcg       420
     gaggccagct accacggcga ctccgcccag ttctgcacga agatcggcac gggcacccac       480
     gtcctcgcga tccaggccag caccaccggc aactcgagca ccgactcggg ctggatcgac       540
     gactggacga tgtcggtccc gcgcttcgaa tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page