(data stored in ACNUC1104 zone)

EMBL: CP000509.PE128

CP000509.PE128       Location/Qualifiers
FT   CDS_pept        146475..148619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0133"
FT                   /product="ATP-dependent DNA helicase, RecQ-like protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: sma:SAV2450 putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79678"
FT                   /db_xref="GOA:A1SCZ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ3"
FT                   /protein_id="ABL79678.1"
FT                   /translation="MSAPAETDVRRSAEAHLRALVGPRPGEPEPVLREDQWAAIEALAV
FT                   HRRRALVVQRTGWGKSAVYFVATLLLREQGAGPTVIVSPLLALMRNQIAAAERAGIRAV
FT                   TINSTNIEDWEPIHEAIAAGEVDVLLVSPERLNNPGFRDEVLPRLAATCGLLVVDEAHC
FT                   ISDWGHDFRPDYRRIRTLLGELPDGIPVLATTATANARVTDDVAEQLGVSTGSATDGFG
FT                   EVLVLRGSLDRESLRLGVVRLRTAEQRLAWLADHLAEQPGSGIVYCLTVAATQEIADYL
FT                   RSRGHEVAAYSGQTDPTERHALEQDLVNGRVKALVATSALGMGFDATLGFVVNMGAPPS
FT                   PVAYYQQVGRAGRGTTLPPEGATVVLLPAIEDRDIWAYFASLAFPREEQVRRTLEVLGA
FT                   EGRPLSTATLETYVDLNRTRLETMLKVLDVDGAVRRVRGGWEATGREWSYDEERYRRVT
FT                   EARQREQQAMLDYIATDACRMRFLRDQLDDPEAEDCGRCDNCGGLTLSADVSAAALEDA
FT                   GARLARPGVAVEPRKMWPSALANLGIELKGKIAEGAQEGRAVARLTDLGHGQALRELFA
FT                   PATPDGPVPVPLVRAVLEVLGDWRPPVDAIVVVESQTRPTLTADLAAGLSRHLGVPVVG
FT                   RWAIVNPDIVPGQGAANSAQRVAAVGRRFALQVDQPLDGLRVLLVDDRTDTGWTLTLAA
FT                   RAVRRAGAAEVRPLVLATTT"
     gtgagtgccc cagccgagac cgacgtacgc cgcagcgcgg aggcgcacct gcgcgcgctc        60
     gtcgggccgc ggccgggtga gccggagccg gtgctgcgcg aggaccagtg ggccgcgatc       120
     gaggcgctcg ccgtgcaccg ccgccgggcg ctcgttgtgc agcgcaccgg ctggggcaag       180
     tccgcggtct acttcgtggc gacgctgttg ctgcgcgagc agggtgccgg gccgacggtc       240
     atcgtctccc cgctgctggc cctgatgcgc aaccagatcg cggcggccga gcgggccggg       300
     atccgcgcgg tgacgatcaa ctccaccaac atcgaggact gggagccgat ccacgaggcg       360
     atcgcggccg gcgaggtcga cgtgctgctg gtcagtcccg agcggctcaa caacccgggc       420
     ttccgcgacg aggtgctgcc ccggctggcc gcgacctgcg gcctcctggt cgtcgacgag       480
     gcgcattgca tctccgactg gggccacgac ttccggcccg actaccgtcg gatccgcacc       540
     ctgctgggcg agctccccga cggcatcccg gtgctcgcga ccaccgcgac cgccaacgcc       600
     cgggtcaccg acgacgtcgc cgagcagctc ggggtctcga cgggctcggc caccgacggc       660
     ttcggcgagg tcctggtgct gcgcggttcg ctggaccgcg agtcgctgcg cctcggcgtg       720
     gtccggctcc ggaccgcgga gcagcggttg gcctggctcg ccgaccacct cgccgagcag       780
     cccgggtccg gcatcgtcta ctgcctgacg gtcgccgcca cccaggagat cgccgactac       840
     ctgcgctcgc gcggccacga ggtcgcggcg tactccggcc agaccgaccc gaccgagcgg       900
     cacgccctcg agcaggacct ggtgaatggc cgggtcaagg cgctggtcgc cacgagcgcg       960
     ctcggcatgg gcttcgacgc caccctcggc ttcgtggtca acatgggcgc gccgccctcg      1020
     ccggtcgcct actaccagca ggtcggccgc gccggccgcg gcacgactct gccgccggag      1080
     ggggcgaccg tcgtgctgct gcccgcgatc gaggaccgcg acatctgggc ctacttcgcc      1140
     tccctcgcct tcccgcgcga ggagcaggtc cgccgcacgc tcgaggtgct gggggcggag      1200
     ggccggccgc tcagcacggc caccctggag acctacgtcg acctcaaccg caccaggctg      1260
     gagacgatgc tcaaggtgct cgacgtcgac ggcgccgtac gccgggtccg cggcggctgg      1320
     gaggccaccg gtcgcgagtg gtcctacgac gaggagcgct accgccgggt gaccgaggcg      1380
     cgccagcgcg agcagcaggc tatgctcgac tacatcgcga ccgacgcctg ccggatgcgg      1440
     ttcctgcgcg accagctcga cgacccggaa gccgaggact gcgggcgctg cgacaactgc      1500
     ggcgggctca ccctctccgc cgacgtctcg gccgccgcgc tcgaggacgc cggcgcccgg      1560
     ctggcccggc ccggggtcgc cgtcgagccg cggaagatgt ggccgagcgc gctggccaac      1620
     ctcggcatcg agctcaaggg caagatcgcc gagggcgccc aggagggccg ggcggtggcc      1680
     cggctcaccg acctcggcca cggccaggcg ctgcgcgagc tcttcgcgcc ggcgaccccg      1740
     gacggcccgg tcccggtgcc gttggtccgc gcggtcctcg aggtgctcgg tgactggcgg      1800
     cccccggtcg acgcgatcgt ggtcgtcgag tcgcagaccc ggcccacgct gacggccgac      1860
     ctggccgccg gcctgtcccg ccacctcggg gtccccgtgg tgggacggtg ggcgatcgtc      1920
     aaccccgaca tcgtccccgg ccagggggcc gccaactccg cgcagcgggt cgccgccgtc      1980
     gggcggcgct tcgccctcca ggtcgaccag ccgctggacg ggctgcgggt gctgctcgtc      2040
     gacgaccgca ccgacaccgg atggacgctg accctggcgg ctcgcgccgt acgccgcgcc      2100
     ggcgccgcgg aggtccgacc gctggtcctc gccaccacca cctga                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page