(data stored in ACNUC1104 zone)

EMBL: CP000509.PE129

CP000509.PE129       Location/Qualifiers
FT   CDS_pept        148881..149261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79679"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ4"
FT                   /protein_id="ABL79679.1"
FT                   /translation="MAEGATNRVAADKEYLDEYGFRGRLQQRVDGLTYAVAGLLTAAPE
FT                   PQELLESVRAAADRGTRFLLVAAGDVETEGLAAQRLLTAAPDLVEVWTVPGAGHVQGLR
FT                   TDPEGWSQRVVGFLDAALVGPR"
     gtggccgagg gggcgacgaa ccgggtcgcc gccgacaagg agtacctcga cgagtacggc        60
     ttccgcggcc ggctccagca gcgcgtcgac ggtctcacgt acgccgtcgc ggggctgctc       120
     accgcggccc cggagccgca ggagctgctc gagtcggtgc gcgccgccgc tgaccgcggg       180
     acccggttcc tgctcgtggc tgcgggggac gtcgagaccg aggggctcgc cgcgcagcgc       240
     ctgctcacgg ccgcaccgga cctcgtcgag gtgtggacgg tgcccggagc cggacacgtg       300
     cagggcctgc ggaccgaccc ggagggctgg tcgcagcgcg tcgtcggctt cctcgacgcc       360
     gccctggtcg gtccccgctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page