(data stored in ACNUC1104 zone)

EMBL: CP000509.PE133

CP000509.PE133       Location/Qualifiers
FT   CDS_pept        152214..154925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0138"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: sco:SCO1167
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79683"
FT                   /db_xref="GOA:A1SCZ8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ8"
FT                   /protein_id="ABL79683.1"
FT                   /translation="MSFVPVTGPATFRAADPPREGVVEFTDDRRTVSLPIRAALPVLTK
FT                   ARSRDDLHPSVGVLSGAALLALRLVAAGKFAPAGSSPPAWRVAGLDADDEQRIVLLARN
FT                   GPDDEQLVRDLLDAVADAMPRTQPRTQPRSRPSAEPSGTTVSRERRPTFEERLQARLAR
FT                   HQRVDARALPQLVTISLRVEADEEELVAGAVRLVAQAHDEQNPLHLCDLALLWTGTPQE
FT                   HGFGERARTHATIALRAAADAWPVLDRLLELRVPDQLTLDSDELVSLLDEGVGALRAAG
FT                   VDVLWPKALGRDLTATTVLDRAAPMTREEPLNEPVLGAEALFAFNWQIALHGDPLTAEE
FT                   MDRLATSASPLLRLRGSWTVVDPSIARKAKKRLVRTVKPAEAVAAALTGTAQIAAPGGE
FT                   QSEQDVVVGASLLKVRDRLLGAATREPVEPPAALRATLRDYQRHGLTWLAEMTSLGLGA
FT                   CLADDMGLGKTVTLIALHLHRAERGHRGPTLVVCPASLLGNWEAEVRRFAPGVPVVRFH
FT                   GTSRDVEAAGDGFVLTTYGTMRRDAEALGSVRWDLVVADEAQHVKNPRTATARALRSIT
FT                   SAARVALTGTPVENDLTELWAILDWTTPGLLGSRNAFRKAWAAPIESGREPAKARQFAD
FT                   LIGPFLLRRRKSDPGIAPELPAKTETDHPLRLTREQVVLYESFVRDTMARIERADPSDP
FT                   VARRGLVLTLLTGLKQICNHPDHFLKRSGARLSGRSEKVDLLDELVGTVLAEDGAVLVF
FT                   TQYVAMARLLEGHLARAGVPHQLLHGGTPVREREAMVARFQAGETPVFLLSLKAGGTGL
FT                   NLTRADHVVHVDRWWNPAVEEQATDRAYRIGQTKPVQVHRMITRGTVEEKVAELLTRKR
FT                   ALADAVLSRGEAALTELSDDELRDFVALRRDP"
     gtgagcttcg tcccggtcac cggcccggcg acgttccgtg ccgccgaccc gccgcgcgag        60
     ggcgtcgtcg agttcaccga cgaccggcgc accgtgagcc tgccgatccg ggcggccctg       120
     ccggtgctga ccaaggcccg ctcgcgcgac gacctgcacc cgagcgtcgg ggtgctgtcc       180
     ggggccgcgc tgctcgccct gcggctggtc gccgcgggca agttcgctcc ggcggggagc       240
     agcccgcccg cctggcgggt ggcgggcctg gacgccgacg acgagcagcg gatcgtgttg       300
     ctggcgcgca acggaccgga cgacgagcag ctggtgcgcg acctgctcga cgccgtggcc       360
     gacgccatgc ccaggaccca gcccaggacc cagcccagga gccggcccag cgccgagccg       420
     agcgggacga cggtctcccg ggagcgccga ccgacgttcg aggagcgcct ccaggcacgg       480
     ctggcgcggc accagcgcgt cgacgcgcgc gccctgccgc agctggtcac catctcgctg       540
     cgggtcgagg cggacgagga ggagctggtc gcgggcgccg tacgcctggt ggcgcaggcg       600
     cacgacgagc agaacccgct gcacctgtgc gacctcgcgc tgctgtggac cgggacaccg       660
     caggagcacg gcttcggcga gcgggcccgc acgcacgcga cgatcgcgct ccgcgcggct       720
     gcggacgcgt ggccggtgct cgaccggctg ttggagctgc gggtgcccga ccagctcacc       780
     ctggacagcg acgagctggt cagcctgctc gacgagggcg tcggtgcgct gcgtgcggcg       840
     ggcgtcgacg tgctgtggcc caaggcgctc ggccgcgacc tcaccgcgac cacggtcctc       900
     gaccgggccg ccccgatgac ccgggaggag ccgctcaacg agccggtgct cggcgccgag       960
     gcgctgttcg cgttcaactg gcagatcgcg ctgcacggcg acccgctcac cgcggaggag      1020
     atggaccggc tcgcgacgtc cgcctcgccg ctgctgcggc tgcggggcag ttggacggtc      1080
     gtcgatccct cgatcgcgcg gaaggcgaag aagcggctgg tccgcaccgt caagcccgcc      1140
     gaggccgtcg ccgccgcgct caccgggacc gcgcagatcg ccgccccggg tggtgagcag      1200
     agcgagcagg acgtcgtcgt cggcgcctcg ctcctcaagg tccgggaccg gctcctgggc      1260
     gccgccacca gggagccggt cgagcctccg gccgcgctgc gggccacgct gcgcgactac      1320
     cagcggcacg gactcacctg gctggcggag atgacctcgc tggggctcgg cgcctgcctg      1380
     gccgatgaca tggggctggg caagaccgtc acgctgatcg cgctgcacct gcaccgggcc      1440
     gagcgcggcc accgaggccc gacgctggtg gtctgcccgg cgagcctgct cggcaactgg      1500
     gaggcggagg tccgccggtt cgccccgggt gtgccggtgg tgcgcttcca cggcacgtcc      1560
     cgtgacgtcg aggcggccgg cgacgggttc gtgctgacga cgtacgggac gatgcggcgc      1620
     gacgccgagg cgctcggctc ggtgcggtgg gacctcgtgg tcgccgacga ggcccagcac      1680
     gtgaagaacc cgcgtacggc gacggctcgg gcgctccggt cgatcacgag cgcggcgcgc      1740
     gtcgccctca ccggcacccc ggtcgagaac gacctcaccg agctgtgggc gatcctcgac      1800
     tggaccacgc ccggtctgct cggcagtcgc aacgccttcc gcaaggcgtg ggcggcgccg      1860
     atcgagtccg gccgcgagcc cgcgaaggcc cggcagttcg cggacctgat cgggccattc      1920
     ctgctccgcc gtcgcaagtc cgaccccggc atcgcccccg agctcccggc gaagaccgag      1980
     accgaccacc cgctgcggct gacccgggag caggtggtgc tctacgagtc gttcgtgcgc      2040
     gacacgatgg cgcgcatcga gcgcgccgac ccctcggacc cggtcgcgcg gcgcgggctg      2100
     gtgctgaccc tgctcaccgg cctcaagcag atctgcaacc accccgacca cttcttgaag      2160
     cgctccggcg cccggctgtc cggccggtcg gagaaggtcg acctgctcga cgagctggtc      2220
     ggcaccgtgc tcgccgagga cggggcggtg ctggtgttca cccagtacgt cgcgatggcg      2280
     cgactgctgg agggccatct cgcccgcgcc ggcgtacccc accagctgct gcacggcggc      2340
     actccggtcc gggagcggga ggcgatggtg gcgcggttcc aggcgggtga gacgccggtg      2400
     ttcctgctct cgctcaaggc cggtggcacc gggctcaacc tgacccgcgc cgaccacgtc      2460
     gtgcacgtcg accggtggtg gaacccggcc gtggaggagc aggcgaccga tcgcgcctac      2520
     cggatcgggc agaccaagcc ggtgcaggtg caccggatga tcacccgcgg caccgtcgag      2580
     gagaaggtcg ccgagctgct gacccgcaag cgtgccctcg ccgacgcggt gctctcccgg      2640
     ggcgaggcgg cgttgaccga gctcagcgac gacgagctgc gcgacttcgt cgcgctgcgc      2700
     cgggacccct ga                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page