(data stored in SCRATCH zone)

EMBL: CP000509.PE138

CP000509.PE138       Location/Qualifiers
FT   CDS_pept        complement(156987..157367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0143"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: nfa:nfa18780 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79688"
FT                   /db_xref="GOA:A1SD03"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD03"
FT                   /protein_id="ABL79688.1"
FT                   /translation="MTTTTLTAAQFEETVTGNDIVLVDFWASWCGPCRQFAPVFEAASE
FT                   KHPDVVFGKVDTEAERELAAAAQITSIPTLMAFREGVLVFAQPGALPATSLEQVIGAVR
FT                   ELDMDDVRAQLAAQSQDQEENQ"
     atgaccacca ccacgctgac tgccgcgcag ttcgaggaga ccgtgaccgg gaacgacatc        60
     gtcctggtcg acttctgggc ctcctggtgc ggcccgtgcc gccagttcgc ccccgtcttc       120
     gaggccgcgt cggagaagca ccccgacgtc gtgttcggca aggtcgacac cgaggccgag       180
     cgcgagctcg ccgcggccgc gcagatcacc tcgatcccga cgctgatggc cttccgcgag       240
     ggcgtgctcg tcttcgccca gccgggcgcc ctgccggcga cctcgctgga gcaggtgatc       300
     ggcgccgtcc gcgagctcga catggacgac gtccgcgccc agctcgccgc ccagagccag       360
     gaccaggagg agaaccagtg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page