(data stored in ACNUC1104 zone)

EMBL: CP000509.PE14

CP000509.PE14        Location/Qualifiers
FT   CDS_pept        16701..17573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0014"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: fal:FRAAL0742 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79564"
FT                   /db_xref="GOA:A1SCM9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM9"
FT                   /protein_id="ABL79564.1"
FT                   /translation="MTTAFVLGGGGVLGAVEVGMLRALLERGIVPDLVLGTSVGALNGA
FT                   LVARQPDLGVIDKLTAMWRGAGKRDGEGDGPQPQQVYGDRPLRTVRRAMSTGTHLWSAG
FT                   PLQRALAAEFGDLTFEDLPVRFQVCAASIERAAEHWFDSGPLVGAVVASAAVPGLLPPA
FT                   RVGDEHFLDGGIVNSIPLGRAVQLGADRVFVLQVGRIDRPLTVPRRPWEVARVSFEIAR
FT                   RHRFIREVEELPEDVEAYVLPARGTSARDDSLLGSRDFASVQARIDETYDASVAYLDEQ
FT                   LGPVSASER"
     atgaccaccg cgttcgtcct cggtggcggc ggcgtcctcg gcgccgtcga ggtcggcatg        60
     ctgcgggccc tgctcgagcg cggcatcgtc ccggacctgg tcctcggcac cagcgtcggc       120
     gccctcaacg gcgccctggt cgcccggcaa cccgacctgg gcgtgatcga caagctcacc       180
     gcgatgtggc gcggtgccgg gaagcgcgac ggggagggcg acgggccgca gcctcagcag       240
     gtgtacggcg accgcccgct gcggaccgtg cgccgcgcga tgtcgaccgg cacccacctg       300
     tggtccgccg ggccgctgca acgggccctg gcggcggagt tcggcgacct caccttcgag       360
     gacctgccgg tccggttcca ggtctgcgcg gccagcatcg agcgcgcggc cgagcactgg       420
     ttcgactccg gcccgctcgt gggggcagtc gtcgcgagcg ccgccgtacc cggtctcctg       480
     ccaccggccc gggtcggcga cgagcacttc ctcgacggcg ggatcgtcaa ctcgatcccg       540
     ttgggccggg cggtgcagct cggcgcggac cgggtcttcg tgctccaggt cgggcgcatc       600
     gaccggccgc tgaccgtgcc ccgccggccc tgggaggtcg cccgggtctc cttcgagatc       660
     gcccgccggc accggttcat ccgcgaggtc gaggagctgc ccgaggacgt cgaggcctac       720
     gtgctcccgg cccgcgggac ctccgcccgc gacgactcgc tgctggggag ccgcgacttc       780
     gccagcgtcc aggcccgcat cgacgagacg tacgacgcct cggtggccta cctcgacgag       840
     cagctcgggc cggtgtctgc gagcgagcgg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page