(data stored in ACNUC1104 zone)

EMBL: CP000509.PE140

CP000509.PE140       Location/Qualifiers
FT   CDS_pept        159674..159841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cgb:cg1481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79690"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD05"
FT                   /protein_id="ABL79690.1"
FT                   /translation="MCHRTTCRRCGKASWAGCGAHVSQVMAGVPKADRCPGHEGEPPLP
FT                   GFLSRLLGRA"
     atgtgtcatc gcaccacctg tcgtcgctgc ggcaaggcca gctgggccgg ctgtggggcg        60
     cacgtctccc aggtgatggc cggcgtcccg aaggccgacc ggtgcccggg ccacgagggc       120
     gagcccccgc tgcccggctt cctcagccgg ctgttgggcc gggcctga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page