(data stored in ACNUC1104 zone)

EMBL: CP000509.PE141

CP000509.PE141       Location/Qualifiers
FT   CDS_pept        160034..161599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0146"
FT                   /product="Hyalin"
FT                   /note="PFAM: Hyalin; KEGG: hch:HCH_03306 protein of unknown
FT                   function (DUF1555)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79691"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003410"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD06"
FT                   /protein_id="ABL79691.1"
FT                   /translation="MQFTTSRAIVRRLVPAAAGAAVLATVASSAALAAPGVTPAHYTDA
FT                   LDPGSTVTITKTVETPPIPPRPDIVFLADTTGSMGGSIANVRSNANAILAQIQAAQPTA
FT                   RFAVAEYKDESDGPAAVFHVDQQLTDSTADVVAGINAWSASGGGDAPEAWIGALGRIPS
FT                   SIDFRPDGTRVLVMFGDAPSHDPSLGFTLGSATSGLQASGVRVIAIDVPGTAGGLDALG
FT                   QATHVTSQTGGSLAAADPDQVASTILSELQNLPAVVTHDTTCDPGASLSFDQASRTVTS
FT                   GDSTTFDETITVAGDAVQGSVLTCTTRFLVNGELPGPEFVQTVEIAVNDVTPPVVTVES
FT                   KTVEATGPDGATVGYTSSATDNVDGPLTPTCTPASGSLFGLGATTVTCAATDAAGNTGT
FT                   GTGTITVVDTTPPSVGCPEAENPGGQVPGAHNEDGFFRLEASDIVDGDVDVYLRDTGSG
FT                   TVFGPYASGQRVKYTENGAKPSVKTMPSGILHITGTGDAEVYAVDFSGNTSAPAACLVP
FT                   QPPK"
     atgcagttca ccacctctcg ggcgatcgtg cgtcgcctcg tcccggcggc cgccggtgcc        60
     gccgtcctcg ccaccgtggc ctcgtccgcg gccctcgccg ctccgggggt gaccccggcg       120
     cactacaccg acgccctgga cccgggcagc acggtgacga tcaccaagac cgtcgagacc       180
     ccaccgatcc cgccgcgtcc cgacatcgtg ttcctggccg acacgaccgg cagcatgggc       240
     ggcagcatcg ccaacgtccg cagcaacgcg aacgcgatcc tggcccagat ccaggccgca       300
     cagcccacgg cccggttcgc ggtcgcggag tacaaggacg agtccgacgg gcccgccgcg       360
     gtcttccacg tcgaccagca gctcaccgac agcaccgcgg acgtggtcgc cggtatcaac       420
     gcctggtccg cctccggcgg cggcgacgcc cccgaggcgt ggatcggcgc gctcggccgg       480
     atcccgtcga gcatcgactt ccgtcccgac ggcacccggg tgctggtgat gttcggcgac       540
     gcgcccagcc acgacccgtc actgggcttc accctcgggt ccgcgaccag cggcctgcag       600
     gccagcggtg tccgggtgat cgccatcgac gtgcccggca ccgccggcgg cctcgatgcg       660
     ctcggccagg ccacccacgt gacctcgcag accggcggct cgctcgccgc ggccgacccc       720
     gaccaggtcg cgagcacgat cctcagcgag ctgcagaacc tgcccgccgt ggtcacccac       780
     gacaccacct gtgaccccgg ggcgtcgctg tccttcgacc aggccagccg cacggtgacc       840
     tccggtgaca gcacgacgtt cgacgagacc atcaccgtcg ccggtgacgc cgtgcagggc       900
     agcgtgctca cctgcaccac gcggttcctc gtcaacggcg agctcccggg acccgagttc       960
     gtccagaccg tggagatcgc ggtcaacgac gtcaccccgc cggtcgtgac cgtcgagagc      1020
     aagaccgtcg aggccaccgg gcccgacggt gcgacggtcg gctacacgtc ctcggcgacc      1080
     gacaacgtcg acgggccgct caccccgacc tgcacgccgg cctcgggcag cctgttcggg      1140
     ctcggcgcga cgaccgtgac ctgcgcggcc acggacgcgg ccggcaacac cggcaccggc      1200
     accggcacga tcaccgtcgt cgacaccacg cccccgtcgg tcgggtgccc ggaggcggag      1260
     aacccgggcg gtcaggttcc gggcgcgcac aacgaggacg gcttcttccg gctcgaggcg      1320
     agcgacatcg tcgacggcga cgtggacgtc tacctgcgcg acaccggcag cgggaccgtc      1380
     ttcgggccgt acgcgtcggg ccagcgggtc aagtacaccg agaacggcgc caagccctcg      1440
     gtgaagacga tgccgagcgg catcctgcac atcaccggca ccggtgacgc cgaggtgtac      1500
     gccgtcgact tcagcggcaa cacgtccgca ccggcggcct gcctcgtccc gcagccgccc      1560
     aagtag                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page