(data stored in ACNUC1104 zone)

EMBL: CP000509.PE142

CP000509.PE142       Location/Qualifiers
FT   CDS_pept        161748..163259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0147"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: sco:SCO2776
FT                   acetyl/propionyl CoA carboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79692"
FT                   /db_xref="GOA:A1SD07"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD07"
FT                   /protein_id="ABL79692.1"
FT                   /translation="MKELVDELRERLATARQGGSEKARRKHTDRGKLLVRDRVDRLLDP
FT                   GSPFLELSPLAADGMYGGAVPSAGVVTGIGRVSGREVVVVANDATVKGGTYYPMTVKKH
FT                   LRAQTVAADNRLPCVYLVDSGGAFLPMQDEVFPDREHFGRIFFNQANLSARGIPQIASV
FT                   MGSCTAGGAYVPAMSDETVIVRNQGTIFLGGPPLVKAATGEVVTAEELGGGDVHARTSG
FT                   VADHLAEDDAHALAIVRSIVETVGPRAAAPWEVHPVEEPHEDPTSLYDVIPADTRTPYD
FT                   VREVIRRVVDGSRFHEFKKLYGETLVTGFARVWGHPVGIVANNGILFSESSLKGAHFIE
FT                   LCNQRGIPLVFLQNITGFMVGKEYENGGIAKDGAKLVTAVACSVVPKFTVVIGGSFGAG
FT                   NYGMCGRAYDPRFLWMWPNARISVMGGEQAASVLATVAGRPDDEEFKAPIREQYETQGS
FT                   PYYSTARLWDDGIIDPADTRRVLGMGLAAAANAPVPAPTYGIFRM"
     atgaaggagc tggtggacga gctgcgcgag cggctcgcga ccgcccggca gggcggcagc        60
     gagaaggccc gccgcaagca caccgaccgc ggcaagctgc tggtgcgcga ccgggtcgac       120
     cgcctcctcg atcccggcag cccgttcctg gagctcagcc cgctggcggc cgacgggatg       180
     tacggcggcg ccgtaccgtc ggccggcgtc gtgacgggca tcggccgggt gagcggccgc       240
     gaggtcgtgg tggtcgccaa cgacgccacg gtcaagggcg gcacctacta cccgatgacg       300
     gtcaagaagc acctgcgcgc gcagacggtc gccgccgaca accggctgcc gtgcgtctac       360
     ctggtcgact ccggcggggc gttcttgccg atgcaggacg aggtgttccc cgaccgcgag       420
     cacttcgggc ggatcttctt caaccaggcg aacctgtcgg cccgcgggat cccgcagatc       480
     gccagcgtga tgggctcgtg caccgccggc ggcgcctacg tccccgcgat gtccgacgag       540
     accgtgatcg tgcgcaacca gggcacgatc ttcctcggcg gccccccgct ggtgaaggcc       600
     gcgaccggtg aggtggtgac ggccgaggag ctcggcggcg gcgacgtgca cgcgcgcacc       660
     tccggcgtgg ccgaccattt ggccgaggac gacgcgcacg cgctggcgat cgtgcgcagc       720
     atcgtcgaga ccgtgggccc gcgcgcggcc gcgccgtggg aggtccatcc ggtcgaggag       780
     ccgcacgagg acccgaccag cctgtacgac gtgatccccg cggacaccag gacgccgtac       840
     gacgtgcgcg aggtgatccg ccgggtcgtg gacggcagcc ggttccacga gttcaagaag       900
     ctgtacggcg agaccctggt caccggcttc gcccgggtct ggggccaccc ggtcggcatc       960
     gtcgccaaca acggcatcct cttcagcgag tcctcgctga agggcgccca cttcatcgag      1020
     ctgtgcaacc agcgcggcat cccgctggtc ttcctgcaga acatcaccgg cttcatggtc      1080
     ggcaaggagt acgagaacgg cggcatcgcc aaggacggcg ccaagctcgt cacggccgtc      1140
     gcctgctcgg tggtgccgaa gttcaccgtc gtcatcggcg gctcgttcgg cgccggcaac      1200
     tacggcatgt gcgggcgcgc ctacgacccg aggttcctgt ggatgtggcc gaacgcccgg      1260
     atctcggtga tgggcggcga gcaggccgcc tcggtgctgg cgaccgtcgc cgggcgtccc      1320
     gacgacgagg agttcaaggc gccgatccgc gagcagtacg agacccaggg ctcgccgtac      1380
     tactcgacag cgaggctgtg ggacgacggg atcatcgacc ccgccgacac ccgccgcgtc      1440
     ctcggcatgg gcctcgcggc cgcggccaac gcgccggtcc cggctcccac ctacggcatc      1500
     ttccggatgt ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page