(data stored in ACNUC1104 zone)

EMBL: CP000509.PE143

CP000509.PE143       Location/Qualifiers
FT   CDS_pept        163348..165252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0148"
FT                   /product="Carbamoyl-phosphate synthase L chain, ATP-binding
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: rso:RSc0265
FT                   probable acyl-CoA carboxylase alpha chain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79693"
FT                   /db_xref="GOA:A1SD08"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD08"
FT                   /protein_id="ABL79693.1"
FT                   /translation="MTNSLAAVLESVLVANRGEIALRVMRACRKYGVRTIAIYTDLDVD
FT                   APHVRAADDAVHVSSYLDIDAVVAAAVASGATAVHPGYGFLSERSAFVRAVEAAGVVFV
FT                   GPPADVMDKMGRKDAAREIAVAAGVPVVPRGEDAGFPVLVKAAAGGGGKGMRVVREEAD
FT                   LEEAKAAAAREALAAFGDDTLLIEKYVERGRHIEVQIMADAHGHVVHLDERDCSTQRRH
FT                   QKVLEEAPAPTISPEVRELVTSSAVALAKQVGYVNAGTVEFLVDDDTGEAYFLEMNTRL
FT                   QVEHPVTELIHHDLDLVLHQLLVALGHPLEIEQDNVRPSGHAIEARVYAEDSFGGFLPQ
FT                   AGRTSIVRWPAGVRVDHALEPDQVVSTSYDPMLGKVIVHGPDRESARRALVDALDRTAI
FT                   LGLTTNVGFLRALVASEEFRDAAIDTAWLDRNSVPAPDDDLPRVFVAWVSAMLAAGHDS
FT                   GQPFRADGWRSGADPAPTIVELDRPVVVDRFAGLVDGRAVRQVAAADHVLTLEVDGRVH
FT                   SAVVNVQPHVAEVVHHGQRFVFERPDVFGDHAVDVGDGAIAAPMPGTVLDVRVEPGATV
FT                   VAGDVLGVLEAMKMELTLKAPFDGTVSQVGATIGAQVALGARLFVVEPHAEAEEEEAG"
     atgacgaatt ccctcgcagc agtcctggag tccgtgctcg tcgccaaccg cggcgagatc        60
     gcgctgcgcg tcatgcgcgc ctgccggaag tacggcgtgc ggacgatcgc gatctacacc       120
     gacctcgacg tcgacgcgcc gcacgtccgg gccgcggacg atgccgtgca cgtctcgagc       180
     tacctggaca tcgacgcggt cgtcgccgcc gccgttgcga gcggggccac cgcggtgcac       240
     cccggctacg gcttcctctc ggaacggtcc gcgttcgttc gtgcggtcga ggccgccggt       300
     gtcgtcttcg tcggaccgcc cgccgacgtc atggacaaga tgggccgcaa ggacgccgcc       360
     cgcgagatcg cggtcgcggc cggcgtgccg gtcgtgccgc ggggcgagga cgcgggcttt       420
     cccgtcctgg tgaaggccgc cgccggaggc ggcggcaagg gcatgcgcgt cgttcgtgag       480
     gaggccgacc tcgaggaggc caaggccgcc gcggcccgcg aggcgctcgc cgcgttcggc       540
     gacgacaccc tcctgatcga gaagtacgtc gagcgcggcc ggcacatcga ggtccagatc       600
     atggccgacg cgcacggcca cgtggtccac ctcgacgagc gggactgctc cacccagcgc       660
     cggcaccaga aggtgctcga ggaggcgccc gcgccgacca tcagccccga ggtccgcgag       720
     ctggtcacca gcagcgccgt ggctctggcc aagcaggtgg gctacgtgaa cgccggcacc       780
     gtcgagttcc tcgtcgacga cgacacgggt gaggcgtact tcctggagat gaacacccgg       840
     ctccaggtcg agcaccccgt caccgagctg atccaccacg acctggacct cgtcctccac       900
     cagctcctcg tcgcgctcgg gcaccccctg gagatcgagc aggacaacgt ccggccgtcc       960
     gggcacgcga tcgaggcgcg ggtgtacgcc gaggactcct tcggcggctt cctgccccag      1020
     gccgggcgca cgtcgatcgt gcgctggccg gccggggtcc gcgtggacca cgcgctcgag      1080
     cccgaccagg tcgtcagcac gtcgtacgac ccgatgcttg gcaaggtcat cgtgcacggc      1140
     cccgaccgag agtccgcgcg ccgcgccctg gtcgacgcgc tggaccggac cgcgatcctc      1200
     gggctcacga ccaacgtcgg gttcctgcgc gcgctggtgg cgagcgagga gttccgcgac      1260
     gccgccatcg acaccgcctg gctggaccgc aacagcgtcc cggcgcccga cgacgacctg      1320
     ccgcgggtct tcgtcgcctg ggtgagcgcg atgcttgccg ccgggcacga cagcgggcag      1380
     ccgttccggg ccgatggctg gcgctccggc gccgaccccg cgccgaccat cgtcgagctc      1440
     gaccggccgg tcgtggtcga ccggttcgcg ggcctggtcg acggccgtgc ggtgcggcag      1500
     gtcgcggccg ccgatcacgt cctcaccctc gaggtcgacg ggcgcgtgca ctcggcggtc      1560
     gtcaacgtgc agccacacgt cgccgaggtc gtccaccacg gccagcgctt cgtgttcgag      1620
     cggcccgacg tgttcggtga ccacgcggtc gacgtcggcg acggggcgat cgccgcaccg      1680
     atgccgggta ccgtcttgga cgtccgcgtc gagcccggcg cgaccgtcgt cgccggcgac      1740
     gtgctcggcg tcctggaggc gatgaagatg gagctgaccc tcaaggcgcc cttcgacggc      1800
     acggtcagcc aggtcggggc caccatcggc gcccaggtcg cgctcggcgc ccggctgttc      1860
     gtggtcgagc cgcacgccga ggccgaggaa gaggaggccg gctga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page