(data stored in SCRATCH zone)

EMBL: CP000509.PE145

CP000509.PE145       Location/Qualifiers
FT   CDS_pept        166369..167466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syd:Syncc9605_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD10"
FT                   /protein_id="ABL79695.1"
FT                   /translation="MSRKVYLHIGAPKTGTTYLQDRLTVNAKTLAAQGVHFPTGSPLVS
FT                   PGLYQFRAALDLLGQDWGGPPGHADGSWEGLVRRARRRSGTVVISHEILAPAAPGQVAR
FT                   AMRDLAGSEIHVVYTARDLARQLPAAWQESIKQGRRWSYRRFLDRFEKGRSWFYRAFDV
FT                   PRVLGTWGAGLPPERVHVVTVPHARVQTQHGDQLWLRMCEVLGIDPVWAPLDSDRSNRS
FT                   LGIAETQVIRQLNRRMDRAARRESTYDALIRDMLAQGELVKRESAAVRLPPERFAWVEE
FT                   RAERWIEWIEGSGVHVVGDVAELRPVRPAEDERWRDPDRVRAKRQLATALDALAAMTRE
FT                   AARRPDPERQLTTRVLAQAQRLRDR"
     atgagtcgga aggtctacct gcacatcggt gcgccgaaga cggggaccac ctacctgcag        60
     gaccggctca cggtgaacgc caagacgctg gccgcgcagg gggtgcactt cccgaccggt       120
     tcgccgctgg tcagccccgg gctgtaccag ttccgcgcgg cgctcgacct gctcggccag       180
     gactggggcg ggccaccggg acacgccgac ggcagctggg agggcctggt ccggcgggcc       240
     cggcgccgct ccgggaccgt cgtgatcagc cacgagatcc tcgcgcccgc ggcgccgggc       300
     caggtggccc gcgcgatgcg cgacctggcc ggcagcgaga tccacgtcgt ctacaccgcg       360
     cgggacctgg cccggcagct gccggccgcg tggcaggaga gcatcaagca gggccggcgc       420
     tggagctacc ggcgcttcct cgaccgcttc gagaaaggcc gtagctggtt ctaccgggcc       480
     ttcgacgtcc cgcgggtcct cggcacctgg ggcgccgggc tgccccccga gcgcgtgcac       540
     gtcgtcaccg tcccgcacgc ccgggtgcag acccagcacg gcgaccagtt gtggctgcgc       600
     atgtgcgagg tgctcggcat cgacccggtg tgggcgccgc tcgacagcga ccgctccaac       660
     cgctcgctgg gcatcgcgga gacccaggtg atccgccagc tcaaccgccg gatggaccgg       720
     gccgctcgcc gggagtcgac gtacgacgcg ctgatccgcg acatgctcgc ccagggtgag       780
     ctggtcaagc gggagtcggc cgcggtccgc ctgcccccgg agcgcttcgc gtgggtcgag       840
     gagcgggccg agcggtggat cgagtggatc gagggcagcg gggtgcacgt cgtcggtgac       900
     gtcgccgagc tgcgcccggt gcgcccggcg gaggacgagc gctggcgcga ccccgaccgg       960
     gtgcgcgcca aacgccagct cgcgaccgcg ctcgacgccc tggccgcgat gacgcgggag      1020
     gcggcccgcc gcccggaccc cgagcgccag ctgaccacgc gggtgctggc gcaggcccaa      1080
     cggctgcgcg accggtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page