(data stored in ACNUC1104 zone)

EMBL: CP000509.PE147

CP000509.PE147       Location/Qualifiers
FT   CDS_pept        168571..169785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79697"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD12"
FT                   /protein_id="ABL79697.1"
FT                   /translation="MSTRVLLHVGTPKTGTSYLQDVLYRNRRTLAAADILYPADRFDAH
FT                   FLAALDLMRLPWGGLEAEAVGAWDRLAARVRGHHGTAIISHEILATASRSQAGRALESL
FT                   GHRAGTEVHLVLSVRDLVRQIPAEWQENVKHRQALTYGAFLDQVQDPQRESRIATWFWG
FT                   VQEIPDILNRWGHDLPPERVHVVTVPPAGGPHQLLWKRFSLVLGLDGLDLDLEAERANP
FT                   SLGAPETALLRRVNRAANRELNPGDYRPLVRELLAHQTLSKRTRSPRLALPPDVHPWTQ
FT                   EVTRSWIAEIEERGYDVVGDLHDLVGAPPVTQYADPDHPAEKQVAAAAVDAIKALLLEG
FT                   ARLRQSEERLRQELRDTQVALERSYLRPTYRWREKVVRRLQGGAVGRQLLAGYRRVRGR
FT                   SSRSA"
     gtgagcacgc gggtcctgtt gcacgtcggt acgccgaaga ccggcacgtc gtacctgcaa        60
     gacgtgctgt accgcaaccg acgcaccctg gcggcggccg acatcctcta tcccgccgac       120
     cgcttcgacg cccacttcct cgcggcgctc gacctgatgc ggctgccctg gggcggcctc       180
     gaggccgagg cggtcggcgc ctgggaccgg ctcgccgccc gggtccgcgg ccaccacggc       240
     accgcgatca tcagccacga gatcctcgcc accgcgtccc gctcccaggc cggccgtgcg       300
     ctggagtcgc tgggccaccg cgccggcacc gaggtgcacc tggtgctctc ggtgcgcgac       360
     ctggtccggc agatccccgc ggagtggcag gagaacgtca agcaccggca ggcgctgacc       420
     tacggcgcct tcctcgacca ggtgcaggac ccgcagcggg agagccggat cgccacctgg       480
     ttctgggggg tccaggagat ccccgacatc ctcaaccggt ggggccacga cctgccgccc       540
     gagcgcgtcc acgtggtcac ggtgccaccg gccggtggcc cgcaccagct gctctggaag       600
     cggttcagcc tggtcctcgg cctcgacggg ctcgacctgg acctggaggc cgagcgggcc       660
     aacccctcgc tcggcgcccc ggagaccgca ctgctgcggc gggtcaaccg ggccgcgaac       720
     cgggagctca acccgggtga ctaccggccg ctggtgcgcg agctgctcgc ccaccagacg       780
     ctctccaagc ggacccggtc gccgcggctg gccctgccgc ccgacgtgca cccgtggacc       840
     caggaggtca cccgctcgtg gatcgccgag atcgaggagc gcggctacga cgtggtgggc       900
     gacctgcacg acctggtcgg cgcgcccccg gtgacgcagt acgccgatcc cgaccacccg       960
     gccgagaagc aggtcgccgc ggcggccgtc gacgcgatca aggcgctgct gctcgagggc      1020
     gcccggctgc gccagtccga ggaacgcctg cgccaggagc tgcgggacac ccaggtcgcg      1080
     ctcgagcggt cctacctgcg cccgacgtac cgctggcgcg agaaggtggt ccgccggctc      1140
     caggggggag cggtcggccg gcagctgctg gcgggctacc ggcgggtgcg cgggcgcagc      1200
     tcgcggtcgg cgtag                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page