(data stored in ACNUC1104 zone)

EMBL: CP000509.PE148

CP000509.PE148       Location/Qualifiers
FT   CDS_pept        complement(169746..170450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79698"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD13"
FT                   /protein_id="ABL79698.1"
FT                   /translation="MSAKGIGGGIGGRIVEKHLVPRVPQLAPDLTASFVREALDRAIHG
FT                   AGPLPAAAAAADKQLREQHGDVKRAVREVIENHVRYAGAQGLLTGVGGVVTAAFAIPAN
FT                   ITGLALIQARMVAGIAHLRGYDLEDARVRNAVLACMLGGDAVDRLVKERKLPAPPMAIA
FT                   TAPVHDPQLDRVLSAEVTSDLITRVAGKRLAITVARRTPVVGGAFGMGADGFATWRIGR
FT                   YADRELRPRTRR"
     atgagcgcca aggggatcgg tggcgggatc ggcgggcgga tcgtcgagaa gcacctcgtg        60
     ccacgcgtgc cgcagctggc gcccgacctg accgcgtcgt tcgtccgcga ggcgctggat       120
     cgggcgatcc acggcgccgg cccgctgccc gccgcggcgg ctgcggccga caagcagctg       180
     cgcgagcagc acggcgacgt caagcgggcg gtccgcgagg tgatcgagaa ccacgtgcgg       240
     tacgccggtg cccagggcct gctcaccggg gtgggcggcg tggtcaccgc cgcgttcgcg       300
     atcccggcga acatcaccgg tctcgcgctg atccaggccc ggatggtcgc gggcatcgcg       360
     cacctgcgcg gctacgacct cgaggacgcc cgggtccgca acgcggtgct ggcctgcatg       420
     ctcggcggcg acgccgtcga ccggctggtc aaggagcgca agctgccggc cccgccgatg       480
     gcgatcgcga ccgcgcccgt gcacgacccg cagctggacc gggtgctctc ggccgaggtc       540
     acctccgacc tgatcacccg ggtcgccggc aagcggctgg cgatcaccgt cgcccggcgc       600
     accccggtgg tgggcggcgc gttcggcatg ggcgccgacg ggttcgcgac ctggcggatc       660
     gggcgctacg ccgaccgcga gctgcgcccg cgcacccgcc ggtag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page