(data stored in SCRATCH zone)

EMBL: CP000509.PE15

CP000509.PE15        Location/Qualifiers
FT   CDS_pept        17570..18589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0015"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   fal:FRAAL0743 hypothetical protein; putative signal
FT                   peptide; putative acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79565"
FT                   /db_xref="GOA:A1SCN0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN0"
FT                   /protein_id="ABL79565.1"
FT                   /translation="MIRLLRRLVIAPAVVALTGLLWFTLPLWVIGAAALSPVVPGRLRP
FT                   LRIMWVAIVYLTCEAILLVVLFGLWLASGFGWRLRSPYFEGIHYDLVQGTMWVFFREAR
FT                   RVLRLRIETEGPAPDAHPGRPVLVCCRHAGPGDSFVLIHTLMAWYAREPRVVLKDTLAW
FT                   DPAIDVILNRIPARFITPNPADGDRLEDQIATLATGLDENDAFVIFPEGGNFTPQRRQR
FT                   AIDRLRRLGMERMAARAERMTHVLAPRPGGFLAALDAAPDADVVLVAHTGLDHLLTVGD
FT                   VWRELPMDKRIVMRWWQVPRGEIPADRDERIDWLYGWWERIDVWIQQNRPEDLSPGRR"
     gtgatccggc tactgcggcg gctcgtgatc gcgccggccg tcgtggcgct gaccgggctg        60
     ctgtggttca cgctgccgct gtgggtgatc ggcgccgccg cgctctcgcc ggtggtgccg       120
     ggccggctgc ggccgctgcg gatcatgtgg gtggcgatcg tctacctcac gtgcgaggcg       180
     atcctcctgg tggtgctgtt cgggctgtgg ctcgcgtccg ggttcgggtg gcggctgcgc       240
     tcgccgtact tcgagggcat ccactacgac ctggtccagg gcacgatgtg ggtgttcttc       300
     cgggaagcgc gacgggtgct gcggctgcgg atcgagaccg agggcccggc accggacgca       360
     cacccggggc ggccggtcct ggtgtgttgc cggcacgccg gaccggggga ctccttcgtg       420
     ctgatccaca ccctgatggc gtggtacgcc cgggagccgc gcgtggtgct caaggacacg       480
     ctcgcctggg acccggcgat cgacgtgatc ctcaaccgga tcccggcccg gttcatcacg       540
     ccgaaccccg cggacggcga tcggctggag gaccagatcg ccaccctggc gaccggactg       600
     gacgagaacg acgcgttcgt gatcttcccc gagggcggca acttcacccc gcagcgccgg       660
     cagcgggcca tcgaccggct ccgccggctc ggcatggagc ggatggccgc gcgcgccgag       720
     cggatgaccc atgtcctggc gccgcggccc ggtggcttcc tcgccgcgct cgacgcggcc       780
     ccggacgccg acgtggtgct ggtggcgcac accgggctcg accacctgct caccgtcggc       840
     gacgtctggc gcgagctgcc gatggacaag cggatcgtga tgcggtggtg gcaggtgccg       900
     cgcggggaga tcccggcgga tcgcgacgag cggatcgact ggctctacgg ctggtgggag       960
     cggatcgacg tctggatcca gcagaaccgg cccgaggacc tgtccccggg ccggcgctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page