(data stored in ACNUC1104 zone)

EMBL: CP000509.PE150

CP000509.PE150       Location/Qualifiers
FT   CDS_pept        171243..171833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79700"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD15"
FT                   /protein_id="ABL79700.1"
FT                   /translation="MTRALILRRGAVAVGLALMASLSACGGDDGGGSGAKAPDDASTDD
FT                   FCATFNSLFEKVLSQATSGDSAAVISALKDWAADIEDVGTPSAMPDDARHGFELFVDQA
FT                   KKLDENASLEDLQNLGDDLSADDQADGEAFTTWTEENCPLDIPGLDGSDLPSIDPSDLP
FT                   SIDPSDLASMDPEELESMMSELASNMSELTESP"
     atgacacgag cactgatcct gcgacggggc gctgtggcgg tcggcctggc gctgatggcc        60
     tcactctcgg cgtgcggcgg cgacgacggc ggcggctcgg gcgccaaggc tccggacgat       120
     gcgtccaccg acgacttctg tgcgaccttc aacagcctct tcgagaaggt gctgtcacag       180
     gcgacctccg gcgactccgc cgcggtgatc tcggcgctca aggactgggc ggcggacatc       240
     gaggacgtcg gcacgcccag cgcgatgccc gacgacgccc ggcacggctt cgagctgttc       300
     gtcgaccagg ccaagaagct cgacgagaac gccagcctgg aggacctgca gaacctcggc       360
     gacgacctca gcgcggacga ccaggcggac ggggaggcgt tcaccacctg gaccgaggag       420
     aactgcccgc tcgacatccc gggcctggac ggctcggacc tgcccagcat cgacccctcg       480
     gacctgccga gcatcgatcc ctcggacctg gccagcatgg accccgagga gctggagtcg       540
     atgatgtccg agctcgcctc gaacatgagc gagctgacgg agagcccgta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page