(data stored in ACNUC1104 zone)

EMBL: CP000509.PE151

CP000509.PE151       Location/Qualifiers
FT   CDS_pept        complement(171864..172199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0156"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: sco:SCO3839
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79701"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD16"
FT                   /protein_id="ABL79701.1"
FT                   /translation="MTQVPTVPIEGVPHPLPDGLVVLDVREPAEWEHGHIEGAVHIPLA
FT                   LLPLRHTELPEAQTLVVCRVGARSAQAVAWLQQQGHDAVNLAGGLLDWEAAGRPMVSDT
FT                   GRPPQVV"
     atgacccagg tcccgaccgt cccgatcgag ggcgtgccgc acccgctgcc cgacgggctg        60
     gtggtgctcg acgtccggga gccggcggag tgggagcacg gccacatcga gggcgccgtg       120
     cacatcccac tcgcgctgtt gccactgcgc cacaccgagc tccccgaggc acagaccctc       180
     gtcgtgtgcc gggtcggcgc ccgatccgcc caggcggtgg cctggctcca gcagcagggc       240
     cacgacgcgg tcaacctggc cggtggcctc ctcgactggg aggcggccgg gcgcccgatg       300
     gtgagcgaca ccggccggcc gccccaggtc gtctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page