(data stored in SCRATCH zone)

EMBL: CP000509.PE154

CP000509.PE154       Location/Qualifiers
FT   CDS_pept        173827..175029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79704"
FT                   /db_xref="GOA:A1SD19"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD19"
FT                   /protein_id="ABL79704.1"
FT                   /translation="MDPIRNPYAPGAGQRPPELAGRDRELEQFEVTLERVAANRPERSM
FT                   VLSGLRGVGKTVLLNALRGQAVRRAWGTGKIEARPDQSVRLPVAQAVHAAVREVAHRHR
FT                   DPDRVDAVAGVLKSFALRTGVDERRAAARAGARWTPPVDVPATRGRADSGDLELDLVEL
FT                   FTDVATLAGDLGVGVALFVDEMQDVAPPELAAVCGACHEISQQGAPLIVVGAGLPHLPV
FT                   ALAASKSYAERLFRYVSVDRLPRPMADRAWRVPAGSEGVTFEEAALDELYRLTDGYPYF
FT                   VQAYGKVTWDAAVGSPIRVADVQAAAPEAEAELAVGFFGARYDRATPAERDYMTAMADL
FT                   GAEHGDAAVATADIARHLARKPQSLSPARDGLIKKGLVYSAERGSVAFTVPHFGKFLRS
FT                   R"
     atggacccga tccgcaaccc gtacgcgccc ggggcgggcc agcggccgcc ggagctggcc        60
     ggccgcgacc gggagctcga gcagttcgag gtcacgctcg agcgggtggc ggccaaccgg       120
     ccggagcgga gcatggtgct ctccgggctg cgcggggtcg gcaagaccgt gctgctcaac       180
     gccctgcgcg gccaggcggt acgccgggcc tggggcaccg gcaagatcga ggcacgaccc       240
     gaccagagcg tccggctgcc ggtcgcgcag gcggtgcacg ccgcggtccg cgaggtcgcg       300
     caccggcacc gcgacccgga ccgggtcgat gcggtcgccg gtgtcctgaa gagcttcgcg       360
     ctgcgcaccg gcgtcgacga gcgccgggcc gcggcgcggg ccggggcccg ctggaccccg       420
     ccggtcgacg tacccgcgac ccggggccgc gccgactccg gcgacctcga gctcgacctg       480
     gtcgagctgt tcaccgacgt cgcgaccctg gccggcgacc tcggcgtcgg cgtcgccctg       540
     ttcgtcgacg agatgcagga cgtcgcgccg cccgagctcg cggccgtgtg cggcgcctgc       600
     cacgagatca gccagcaggg cgccccgctg atcgtcgtcg gcgccgggct gccgcacctg       660
     ccggtcgcgc tggccgcgtc gaagtcgtac gccgaacgcc tgttccgcta cgtctcggtc       720
     gaccggctgc cccgcccgat ggccgaccgc gcctggcggg tcccggccgg cagcgagggc       780
     gtcacgttcg aggaggcggc cctcgacgag ctgtaccggc tcaccgacgg ctacccgtac       840
     ttcgtgcagg cctacggcaa ggtcacctgg gacgccgccg tcggctcccc gatccgggtc       900
     gccgacgtgc aggccgcagc gcccgaggcc gaggcggagc tggccgtcgg cttcttcggc       960
     gcccgctacg accgggcgac ccccgccgag cgggactaca tgaccgcgat ggccgacctc      1020
     ggcgccgagc acggggacgc cgcggtcgcc actgccgaca tcgcccggca cctcgcccgc      1080
     aagccgcagt cgctctcgcc cgcccgtgac gggctgatca agaagggcct ggtctactcc      1140
     gccgagcggg ggagcgtcgc cttcacggtg ccgcacttcg gcaagttcct gcgctcgcgc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page