(data stored in SCRATCH zone)

EMBL: CP000509.PE155

CP000509.PE155       Location/Qualifiers
FT   CDS_pept        175148..175516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0160"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mlo:mlr1095 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79705"
FT                   /db_xref="GOA:A1SD20"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD20"
FT                   /protein_id="ABL79705.1"
FT                   /translation="MDLVQIAQRADDLERATAFYTLLLGSPPVATYEPPGLVFFDLGGV
FT                   RLLIEHGAPSATVYLRVEDIDAAVAQAREAGTEVASEPHVIFAHADDTLGPRGTDEWQA
FT                   FIRDSEGNLVGLVEHRPR"
     gtggacctcg tccagatcgc gcaacgggcc gacgacctcg agcgggcgac cgcgttctac        60
     acactgctgc tcggcagccc gccggtcgcg acctacgaac cgccggggct ggtgttcttc       120
     gacctcggtg gcgtgcggct gctgatcgag cacggcgcgc cgagcgccac ggtgtacctg       180
     cgcgtcgagg acatcgacgc cgccgtggcg caggcccggg aggccgggac cgaggtcgcc       240
     tccgagccgc acgtcatctt cgcccacgcc gacgacaccc tcggcccgcg gggcaccgat       300
     gagtggcagg cgttcatccg cgactccgag ggcaacctcg tgggtctggt cgagcaccgg       360
     ccccggtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page