(data stored in ACNUC1104 zone)

EMBL: CP000509.PE157

CP000509.PE157       Location/Qualifiers
FT   CDS_pept        176321..177259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0162"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: sma:SAV4226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79707"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD22"
FT                   /protein_id="ABL79707.1"
FT                   /translation="MAKKSRTKARDHQPASGEVGPRQPCPCGSGKRYKACHGAAGGAPA
FT                   PFVNRPFEGLPSECDIVAMRELVPAATAPLTLVDHADRTVQLCTLLPMAAPAMVRDSGE
FT                   IWLGLQVQHNFGDPARDLGAVLAKALTADAGIVGLTDPPGEGPRLQDLVTGDRLAVTVH
FT                   EGFEFWIGDVEESERAGMAAALEQANTAAMPTARLTTVEAAYWTDVGTKEHLRWVLPEP
FT                   EDRLLDALARLHAAGNDGLVAGSRFVGMFRAHGLLAPVWDLPLGTGPEPLEEPAERFAA
FT                   DLAQALADTSDLTADERAARSGLANRQVTIR"
     atggcgaaga agtcccgcac caaggcccgc gaccaccagc ccgcctccgg cgaggtcgga        60
     ccgcggcagc cctgcccgtg cgggtccggc aagcggtaca aggcctgcca cggcgcggcc       120
     ggcggggccc cggctccgtt cgtcaaccgg cccttcgagg ggctgccctc ggagtgcgac       180
     atcgtcgcga tgcgcgagct ggtgccagcg gccaccgccc cgctcaccct cgtggaccac       240
     gcggaccgga ccgtgcagct gtgcacgttg ctgccgatgg ccgcgccggc gatggtgcgc       300
     gacagcgggg agatctggct cgggctccag gtccagcaca acttcggcga ccccgcacgc       360
     gacctcggcg cggtgctcgc caaggcgttg accgcggacg ccggcatcgt gggtctcacc       420
     gatccgccag gtgaaggccc gcggcttcag gacctggtca ctggcgaccg gctggcggtg       480
     acggtgcacg agggcttcga gttctggatc ggcgacgtcg aggagagtga acgggccggg       540
     atggcggccg cgctcgagca ggccaacacc gcggccatgc cgaccgcccg gctgaccacc       600
     gtcgaggcgg cgtactggac cgacgtcggc accaaggagc acctgcgctg ggtgctgccc       660
     gagccggagg accggctgct ggacgcgctc gcgcgactgc acgccgcggg gaacgacggg       720
     ctggtcgcgg gctcccgctt cgtcggcatg ttccgggcgc acgggctgct cgcgccggtc       780
     tgggacctgc cgctcggcac cgggcccgag ccgctcgagg agccggccga gcggtttgcc       840
     gccgacctcg cgcaggcgct ggccgacacc tccgacctca ccgccgacga gcgggcggca       900
     cgatccgggc tcgccaaccg ccaggtcacc atcaggtaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page