(data stored in ACNUC1104 zone)

EMBL: CP000509.PE16

CP000509.PE16        Location/Qualifiers
FT   CDS_pept        complement(18611..19255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090120000081 predicted protein Pfam:
FT                   IncA TolA PROSITE: ALA_RICH ARG_RICH GLU_RICH GLY_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79566"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN1"
FT                   /protein_id="ABL79566.1"
FT                   /translation="MGLRKKKSLIDQASETVTQYVDQVKPQLESAVATAREKAGPVIAD
FT                   ARTKAAPVLADARAKAAPVIAEARAKAAPAIASGAALAAEKVAAGASLAAERAAEAADA
FT                   AATKVTEVATPRKKKRGKGKKLLLLTGLAALAAFVAKKLRGSDQSANWQSSYTPTPAPA
FT                   PASPAAAPAQPTDDEGGSSPDEAIADQAEAPHPVTTPDDPAEVVEVDENKG"
     atgggtctgc gcaagaagaa gtccctgatc gaccaggcga gcgagaccgt cacccagtac        60
     gtcgaccagg tcaagccgca gctcgagtcc gcggtcgcca cggcgcgtga gaaggccggg       120
     ccggtgatcg ccgacgcgcg caccaaggcc gcccccgtgc tcgccgacgc ccgggccaag       180
     gccgcaccgg tcatcgccga ggcccgtgct aaggccgcac cggccatcgc ctcgggcgcc       240
     gccctggccg ccgagaaggt cgccgccggc gcgagcctcg ccgcggaacg ggccgcggag       300
     gccgccgatg ccgcggccac caaggtcacc gaggtcgcca cacccaggaa gaagaagcgt       360
     ggcaagggca agaagctgct cctgctgacc ggcctggccg ccctcgctgc gttcgtggcc       420
     aagaagctcc gcggcagcga ccagagtgcg aactggcagt cctcctacac gccgaccccg       480
     gcgcccgcgc cggcctcgcc cgccgccgcg ccggcccagc ccaccgacga cgaggggggc       540
     tcgtcgccgg acgaggcgat cgccgaccag gccgaggccc cgcaccccgt caccacgccc       600
     gacgacccgg ccgaggtcgt cgaggtggac gagaacaagg gctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page