(data stored in ACNUC1104 zone)

EMBL: CP000509.PE160

CP000509.PE160       Location/Qualifiers
FT   CDS_pept        complement(179430..179804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0165"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mmc:Mmcs_2490
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79710"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD25"
FT                   /protein_id="ABL79710.1"
FT                   /translation="MAESFYDAFAPEEIARIAAAGTRVHVPEGWSPIWEKTPADKAYII
FT                   LDGTVSVRHRGEEIAQLGAGEIVGEAAIVNHSLRTASIVALTPLELIHFTDEAVRRLCA
FT                   EMPAFKTALEAVAVERFGRN"
     atggctgagt cgttctacga cgcgttcgcg cccgaggaga tcgcgcgcat cgctgcggcg        60
     ggcacccgcg tccacgtccc ggagggctgg tcgccgatct gggagaagac gccggccgac       120
     aaggcgtaca tcatcctgga cggcacggtc tcggtgcgcc accgcggcga ggagatcgcc       180
     cagctgggtg ccggcgagat cgtcggcgag gccgcgatcg tcaaccactc gctgcgcacg       240
     gcgtcgatcg tcgccctcac gccgttggag ctgatccact tcaccgacga ggcggtacgc       300
     cggctctgcg ccgagatgcc cgccttcaag accgccctcg aggccgtcgc ggtggaacgg       360
     ttcggccgaa actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page