(data stored in SCRATCH zone)

EMBL: CP000509.PE162

CP000509.PE162       Location/Qualifiers
FT   CDS_pept        complement(181155..181745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0167"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   fal:FRAAL0931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79712"
FT                   /db_xref="GOA:A1SD27"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD27"
FT                   /protein_id="ABL79712.1"
FT                   /translation="MDPVVIGLTFLAIFVVELPDKTFLATLVLATRYRPILVWLGVGLA
FT                   FAVQTTVAVLLGHAVSFLPDDAVRAGAALMFLAGAVILVREGRGHQQAAAEDTPAPTRD
FT                   RHGLQAVVASFLVLFAAEWGDLSQLLTISLVAKYEQPFSVYAGALGALLVVSGLAVLAG
FT                   RQLQRFISLHVLHYVGAAVCLTLATFTAYDLLA"
     atggacccgg tcgtcatcgg cctcaccttc ctcgccatct tcgtggtcga gctgcccgac        60
     aagacgttcc tcgcgacgct ggtgctggcc acccggtacc gcccgatcct ggtctggctc       120
     ggcgtcggcc tcgccttcgc cgtccagacg acggtggcgg tgctgctcgg ccatgcggtg       180
     tcgttcctgc ccgacgacgc ggtccgtgcc ggggcggccc tgatgttcct ggccggagcg       240
     gtgatcctgg tccgagaggg ccgcgggcac cagcaggccg ccgccgagga caccccggca       300
     cccacgcgcg acaggcacgg cctgcaggcg gtggtcgcca gcttcctggt gctcttcgcc       360
     gccgagtggg gcgacctgtc ccagctgctc acgatctccc tggtcgcgaa gtacgagcag       420
     ccgttctcgg tgtacgccgg ggccctcggc gcgctcctgg tcgtcagtgg cctggccgtc       480
     ctggccgggc gccagctcca gcgcttcata tccctgcacg tgctgcacta cgtcggtgcg       540
     gcggtctgcc tgaccctggc gaccttcacg gcttacgacc tgctggcctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page