(data stored in ACNUC1104 zone)

EMBL: CP000509.PE166

CP000509.PE166       Location/Qualifiers
FT   CDS_pept        184780..185208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH3328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79716"
FT                   /db_xref="GOA:A1SD31"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD31"
FT                   /protein_id="ABL79716.1"
FT                   /translation="MARHSLGAVEILAVLVAILALLVAVVVGLVTLRRTAPGRGDGADA
FT                   LPEDVHGLRQEVAALRAEAAAALRHLAVVRYDAFGDMGGHLSWSLALLDDGGDGVVLTS
FT                   IHGRSDARTYAKGIRGWRCDQQLSPEELEAVANARPRG"
     gtggcgcgac atagtctcgg ggccgtggag atcctggccg tgctcgtcgc catcctcgcg        60
     ctgctggtcg ccgtcgtcgt cggcctggtc accctgcgcc ggaccgcgcc cggccgtggt       120
     gatggggccg acgccctccc cgaggacgtg cacggcctgc gccaggaggt cgcggcgctg       180
     cgggccgagg cggcggccgc gctgcgccac ctcgcggtgg tgcgctacga cgccttcgga       240
     gacatgggtg gacacctctc gtggtcgctg gcgctcctcg acgacggcgg cgatggcgtc       300
     gtgctcacct cgatccacgg ccggagcgac gcccgcacct acgccaaggg catccgcgga       360
     tggcgctgcg accagcagct ctcgcccgag gagctggagg ccgtcgcgaa cgcccgccct       420
     cgcggctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page